KEGG   Mycobacterium sp. JS623: Mycsm_05650Help
Entry
Mycsm_05650       CDS       T02423                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00480  Glutathione metabolism
msa00590  Arachidonic acid metabolism
msa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Mycsm_05650
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Mycsm_05650
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Mycsm_05650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AGB25827
UniProt: L0J5G2
Position
complement(5609768..5610259)
Genome map
AA seq 163 aa AA seqDB search
MTSLNEIALTTLDGRATTLAELADGAALVVNVASKCGLTPQYTALEQLAKDYGDRGLTVI
GVPCNQFMGQEPGTAEQIQTFCSTNYGVTFPLLAKTDVNGADRHPLYAELTKATDDSGEA
GDIQWNFEKFLLAPGGQVVNRFRPRTAPDAPEVIAAIEAVLPR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgctgaacgaaatcgccctgacgacgctggacgggcgagccaccacgcttgcc
gagctcgcagacggcgccgcgctggtggtgaacgtcgcgtcgaaatgcggcctcaccccg
caatacaccgcgctggagcagctggcgaaagattacggcgaccgcggtctgacagtcatc
ggcgtgccgtgcaaccagttcatgggtcaggagccgggcacggccgagcagatccagaca
ttctgttcgaccaattacggcgtgacgttcccgctgctcgccaagaccgacgtcaacggc
gccgaccgccatccgctctatgcggaactcaccaaggccaccgacgacagcggcgaggcg
ggcgacatccaatggaacttcgaaaagttcctgctcgcaccgggtggccaggtggtcaac
cggttccggccgcgcaccgctcccgacgcacccgaggtgatcgcggccatcgaggccgtc
ctgccgcgatag

DBGET integrated database retrieval system