KEGG   Mycobacterium sp. JS623: Mycsm_06028Help
Entry
Mycsm_06028       CDS       T02423                                 

Definition
(GenBank) TIGR03442 family protein
  KO
K07008  gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00340  Histidine metabolism
msa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Mycsm_06028
Enzymes [BR:msa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.118  gamma-glutamyl hercynylcysteine S-oxide hydrolase
     Mycsm_06028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_4
Motif
Other DBs
NCBI-ProteinID: AGB26192
UniProt: L0J6E3
Position
complement(5992929..5993621)
Genome map
AA seq 230 aa AA seqDB search
MCRHLGWLGDPQSIASLVLEPASGLLVQSYAPRRQKHGLMNADGWGVGFFDNGVARRWRS
AAPLWGDASFASVAPALRSNCVVAAVRSASIGMPIEPSASAPFSDGQWLLSHNGLVDRGV
LPLSSKAESTVDSALLAALIFERGLDALGDTIVEVAAADPNARLNILAGNGSELRATTWG
DTLSVLRRDDGVVLASEPYDDNPDWQEIPDRHLVVVEGPRVDLIPLKGSQ
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtgccggcatctcggctggctcggcgacccgcaatcgatcgcgtcgcttgtgctggag
cccgcgtcgggcctgctggtccagtcgtatgctcctcggcggcaaaagcacggcctgatg
aacgcggacggctggggcgtcggctttttcgacaatggtgtggcgcggcggtggcgcagc
gccgcaccgctgtggggtgacgcgtcgttcgcctccgtggcgcccgcattgcgcagcaat
tgcgttgtcgcagcggtgcgttcggcgagtatcggcatgccgatcgaaccgtcggcgtcg
gcaccgttcagtgatggccaatggctgttgtcgcacaacggcctcgtcgaccgcggcgtg
ttgccgttgtcctcgaaagcagaatcgaccgtcgacagcgcactgctggccgcactgatt
ttcgagcgaggcctcgacgcactcggcgacacgatcgtcgaggttgccgccgccgacccc
aatgcccggctgaacatcctggcgggcaacggatctgaactccgcgccaccacgtggggc
gacaccctgtcggtattgcgtcgagacgacggcgtggttctggccagcgaaccatatgac
gacaaccccgactggcaggaaatccccgaccgccatctcgtcgtggtcgaggggcctcgc
gtcgacctgatccccctgaagggctctcaatga

DBGET integrated database retrieval system