KEGG   Mycobacterium sp. JS623: Mycsm_06072Help
Entry
Mycsm_06072       CDS       T02423                                 

Definition
(GenBank) penicillin-binding protein, beta-lactamase class C
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AGB26233
UniProt: L0J5T5
Position
complement(6034509..6035798)
Genome map
AA seq 429 aa AA seqDB search
MTKASLLRAEEGLPRGVQGAADSRFSNVVRVFAGLFPGKRFGGGALSVYIDGRPVVDVWM
GWSDRAGEQPWTSDTGAMVFSATKGVAATVIHRLVDRGLLDYDEPVATYWPEFGANGKDA
ITIRDVLRHRSGLSHLKGVGRDELLDHELMEQRLAAASVDRLRGWPAYHALTYGWILSGL
TRAVTGQGMRELIRDEVARPLDTDGLHLGRPPAGSPTKVAQILAPQSTRGNPVFNFVAPK
VAGLPLSGAFGAMFFPGIKSFVQGDIPFLDGEVPAANGVVTARGLAKMYAAIANDGRIDG
TQFLSSDLAQGLIGNPKPWPDLNIVVPMPFHLGYHESPIPGLLKGFGHFGLGGTLGWADP
ASGAAFAFVHNRLLTPMVLDMASFAGLARPLRNAITAARHAGALAVPRYGARYRDANQKE
PKKRLAGRR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggcgtcgctgctccgcgctgaagaaggcctgccccgcggagttcagggggcg
gccgattcgcggttttccaatgtcgttcgtgtcttcgcggggttgttccccggaaagcgg
ttcgggggcggcgcgctttcggtgtacatcgacggacggccggtcgtcgacgtctggatg
ggttggtccgaccgcgctggggaacagccgtggacaagcgacaccggtgccatggtgttc
tcggcgacgaaaggcgtggcggcgacggtcattcaccgcctggtcgaccgcggcctgctg
gactacgacgagccggtcgcgacgtactggcccgagttcggcgccaacggcaaggacgcc
atcacgatccgcgatgtgctgcggcaccgatccgggctgtcacacctgaagggagtgggc
cgcgacgagttgctcgatcacgagctgatggagcagcggctggccgctgcgtcggtcgac
cgtctgcgtggctggccggcctaccacgcgctgacgtacggctggattctgtccgggttg
acccgtgcggtgaccggtcagggcatgcgtgaactgatccgcgatgaggtggcccgccct
ctcgacaccgacggtctgcatttgggccggccgcccgctggctcaccgaccaaggtcgcg
caaatccttgcgccacaaagcacccgcggcaatccagtgttcaacttcgtcgcaccgaag
gtggcagggctgccgctctctggcgcgttcggggcgatgttctttcccggcatcaaatcg
tttgtgcagggcgatattccattcctcgacggcgaggtgcctgccgccaacggcgtcgtc
accgcccgcggtctggccaagatgtacgcggcgatcgccaacgacggcaggatcgacggc
acccaattcctgtcgagcgacctggcgcagggattgatcggaaacccgaagccgtggccc
gacctcaacatcgtcgtaccgatgccgttccatctgggctatcacgaatcgccgatcccc
ggactgctcaagggctttggtcacttcggacttggtggcaccctcggctgggccgacccg
gcgtcgggcgcggcgttcgcgttcgtacacaaccggttgttgacaccgatggtgctcgac
atggcgtcgttcgccggacttgctcggccattacgcaacgcgatcaccgcggcgcggcac
gcgggcgcccttgcggtgccgagatacggtgcgcgctatcgcgatgccaatcaaaaggag
cctaagaagcggctcgctggacgccgctag

DBGET integrated database retrieval system