KEGG   Mycobacterium sp. JS623: Mycsm_06074Help
Entry
Mycsm_06074       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGB26235
UniProt: L0J3U8
Position
complement(6036417..6036650)
Genome map
AA seq 77 aa AA seqDB search
MRLFCRLRPGVLVITTIAVIAAMGGLPVPDAQAFYIQNHERITRDALTPIGVDNATQNQI
LVGPPPGAGAVERLILQ
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttttctgccgactccggccgggcgttttggtcatcacgacgatagccgtgatc
gctgcgatgggcgggttgcccgtcccggatgcgcaggccttctacatccagaaccatgag
cgcatcacgcgcgatgcgctcacaccaatcggggtcgacaacgccacccagaaccagata
ctcgtcggcccgccgcccggtgccggggcagtggagcgactcattcttcagtga

DBGET integrated database retrieval system