KEGG   Mycobacterium sp. JS623: Mycsm_06091Help
Entry
Mycsm_06091       CDS       T02423                                 

Definition
(GenBank) cytochrome P450
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: AGB26251
UniProt: L0J7F8
Position
complement(6052413..6053636)
Genome map
AA seq 407 aa AA seqDB search
MTATADPQALLLQLLDRSNRANPYPAYERIRERGPLQLPHMTLNVFSSFADCDEVLRHPS
SASDRLKSTAAQREIAAGAEARPIGPPGFLFLDPPDHTRLRKLVSKAFAPKVVKALEPSI
TEMVDSLLDKVAAAERFEVINDLAYPLPVAVICRLLGVPIEDEPQFSRASALLAAALDPV
LSFTGEANESFDEMVEAGMWLRGYLRDLIVRRRSDPGEDLMSALIHVEESGDQLTEEEII
ATCNLLLVAGHETTVNLIANAILAMLRHPEHWQALAADPQRVSAVVEETLRYDPPVQLMG
RIAADDMTIGDTDVPRGDVMVLLLAAAHHDPAAFDRPAEFDPDRENIRHLAFGKGPHFCL
GAPLARLEAAVALTKVTERFPRSRLVGEPAYKPNVTLRGMASLEVAI
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctaccgcggatccacaggccctgctgctgcagctgctcgaccggtcgaaccgg
gccaacccgtaccccgcctatgaacggatccgcgagcgcgggcccctgcaactgccgcac
atgacgctgaatgtgttctcgtcgtttgccgactgtgacgaggtgctgcgccatccgtcg
tcggccagcgaccggctcaagtcaaccgccgcacagcgcgagatcgccgcgggcgccgag
gcccgccccattggtccgccgggatttctgttcctcgacccgcctgaccacacgcggctg
cgcaagctggtgagcaaggccttcgcgccgaaggtcgtcaaggccctggagccgagcatc
accgagatggtcgactcgctactggacaaggtcgcagccgccgagcgcttcgaggtcatc
aacgatctggcttatccgctgcccgtcgcggtgatctgccgactgctcggcgtaccgatc
gaggacgagccgcagttcagccgggcatcggcgctgctggccgcggcactggatccggtg
ttgtcgttcaccggtgaggccaacgaaagtttcgacgagatggtcgaggccgggatgtgg
ctgcgcggctatctgcgggatctgatcgtgcgcaggcgaagcgatccgggggaggacctg
atgtcggcgttgatccacgtcgaggaatcgggcgatcagctgaccgaagaagagatcatc
gcgacgtgcaacctgctgctggttgccggacatgagacgacggtgaacctgatcgccaac
gccattctcgcgatgctgcggcatcccgagcactggcaggcgctggccgctgacccgcaa
cgggtttcagccgtcgtcgaggagacgttgcggtacgacccgccggtccagttgatgggc
cgaattgctgccgacgacatgacaattggcgacaccgacgtcccgaggggggacgtgatg
gtgctgctgttggccgcggcgcaccacgatcccgcggcattcgatcggccagccgagttc
gaccccgatcgggagaacattcgccacctggcgttcggcaagggtccgcacttctgtctc
ggcgcgccgctggcacgcctggaggccgctgttgcactgacgaaggtcaccgagcgcttc
ccgcgttcacggctggtcggtgaacctgcatacaagccgaacgtgaccttgcgtggaatg
gcgtcattggaggtcgccatctag

DBGET integrated database retrieval system