KEGG   Mycobacterium sp. JS623: Mycsm_06092Help
Entry
Mycsm_06092       CDS       T02423                                 

Definition
(GenBank) tRNA-guanine transglycosylase
  KO
K00773  queuine tRNA-ribosyltransferase [EC:2.4.2.29]
Organism
msa  Mycobacterium sp. JS623
Brite
KEGG Orthology (KO) [BR:msa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:msa03016]
    Mycsm_06092
Enzymes [BR:msa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.29  tRNA-guanosine34 transglycosylase
     Mycsm_06092
Transfer RNA biogenesis [BR:msa03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Mycsm_06092
 Prokaryotic Type
    Mycsm_06092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TGT
Motif
Other DBs
NCBI-ProteinID: AGB26252
UniProt: L0J6L5
Position
complement(6053641..6054906)
Genome map
AA seq 421 aa AA seqDB search
MTVPNTPRPRDSSASFFSVDAELPGRLGRAGIIRTPHGDIHTPAFIAVGTQATVKAVLPE
TMKDLGAQAVLANAYHLYLQPGPDIVEEAGGLGAFMNWHGPTFTDSGGFQVLSLGAGFKK
VLAMDTERVQADDVIAEGKERLAHVDDDGVTFRSHLDGSTHRFTPEVSIGIQHKLGADVI
FAFDELTTLVNTRAYQEESVKRTHDWAVRCLVEHRRLTALHPSKPAQALFGVVQGAQYED
LRRQATRGLTTIVDEDGRGFDGYGIGGALEKQNLATIVGWVSSELPADKPRHLLGISEPD
DLFDAVAAGADTFDCVSPSRVARNAAVYGPTGRFNITNSRYRRDFSPIDADCDCYTCAHY
TRAYLNHLFKAKELLAKTLATIHNERFVIRLVDQIRAAIRTGEFDELRAHVLGQYYSTRA
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgccgaatactcctcgtccgagagactcgtcggcgtcgttcttcagcgttgac
gccgaattgcccggacgactcggtcgcgccggcatcatccgcactccccacggcgacatc
catacgccggcgttcatcgccgtcggcacccaggccaccgtcaaggccgtcctgcccgaa
accatgaaagaccttggcgcgcaagcggttctggccaacgcctaccacctgtatctgcag
cctggccccgacatcgtcgaggaggcaggtggccttggcgcgttcatgaactggcacggg
ccgacgttcaccgatagcggcgggttccaggtgttgtcgctgggtgccggcttcaagaag
gtgctggcgatggacaccgaacgggtgcaggccgacgacgtcatcgccgagggcaaggag
cggctggcccatgtcgacgacgacggagtcacattccgctcgcatctcgacgggtccaca
caccgcttcacccccgaggtgtcgatcggcattcagcataagctcggcgctgacgtcatc
ttcgccttcgacgagctgaccacgctggtcaatacccgcgcctaccaggaagagtcggtg
aagcgcacccacgactgggcggtgcgctgtctggtcgagcaccgccggttgactgcgctg
cacccgtcaaagccggcgcaggcgttgttcggcgtggtgcagggcgcccagtacgaggac
ctgcgcaggcaggccacccggggactgacgaccatcgtcgatgaggacgggcgcgggttc
gacggctacggcatcggcggcgcactggagaagcagaacctggcgacgatcgtcggctgg
gtcagcagtgaactgcccgcggacaagccccgccacctgctgggcatcagcgagcccgac
gatctgttcgacgcggtcgcggcgggcgccgacactttcgactgcgtatcgccgtcgagg
gtcgcgcgcaacgccgcggtctacgggccgaccggccgcttcaacatcaccaattcgcgg
taccggcgtgacttcagccccatcgacgccgactgcgactgctatacctgcgcccactac
acccgcgcctacctgaaccatctgttcaaggcgaaagaactcctggcgaagacgctcgcc
accatccacaacgagcgctttgtcatccggctcgtcgaccagattcgcgcggcgatccgc
accggcgagttcgacgaactccgcgcacacgttctgggccagtactactcgacgcgtgca
caataa

DBGET integrated database retrieval system