KEGG   Mycobacterium sp. JS623: Mycsm_06093Help
Entry
Mycsm_06093       CDS       T02423                                 

Definition
(GenBank) conserved lipoprotein/antigen
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Myco_19_kDa
Motif
Other DBs
NCBI-ProteinID: AGB26253
UniProt: L0J5V9
Position
6054951..6055355
Genome map
AA seq 134 aa AA seqDB search
MTLAVAGCSSGPPDYKPGPGTLVAGTAQVTVNGQNVGTTEAVQCTPAGSLTTITTGDQAS
GVTALISNKDELAADAVSLNNVGGFTGSYNRGLGEDAKVTMTGRTYDITGAAVGFATANP
SFRTTGTFAIKVAC
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctggccgtcgccgggtgttcgtcggggccgccggactacaagcccgggccgggc
acgctcgtcgctggcaccgcgcaggtcaccgtcaacggccagaatgtcggcaccaccgag
gcggtgcaatgcacgcctgcgggctcgctgaccaccatcaccaccggcgatcaggcgtcg
ggagtgaccgcgctgatctccaacaaggacgagctggccgccgatgccgtcagcctcaac
aacgtcggcggcttcaccggtagctacaacagaggcctcggcgaggatgcgaaggtcacg
atgaccggcaggacctacgacatcaccggggcggccgtcggcttcgccaccgccaatccc
agcttcaggacgacaggcacgttcgcgatcaaggtcgcctgctag

DBGET integrated database retrieval system