KEGG   Mycobacterium sp. JS623: Mycsm_06094Help
Entry
Mycsm_06094       CDS       T02423                                 

Definition
(GenBank) putative hydrolase or acyltransferase of alpha/beta superfamily
  KO
K01563  haloalkane dehalogenase [EC:3.8.1.5]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00361  Chlorocyclohexane and chlorobenzene degradation
msa00625  Chloroalkane and chloroalkene degradation
msa01100  Metabolic pathways
msa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mycsm_06094
   00361 Chlorocyclohexane and chlorobenzene degradation
    Mycsm_06094
Enzymes [BR:msa01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.5  haloalkane dehalogenase
     Mycsm_06094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase Chlorophyllase
Motif
Other DBs
NCBI-ProteinID: AGB26254
UniProt: L0J4N6
Position
complement(6055352..6056257)
Genome map
AA seq 301 aa AA seqDB search
MQTLRTPDERFANLPEFPYPAKYCEVDDGDGGQLRVAWVEVGPAEGNPVLMLHGEPSWSF
LYRKMMPVLAAAGYRVICPDLVGFGRSDKPTRIGDHAYARHVEWMRAVAFDVLDLQHVTL
VGQDWGGLIGLRIAAENPDRFARIVVANTGLPTGDHPMPEVWWNFRKAIQGASQLDVGRW
VEAGCARPFTGAIRAAYSAPFPDDSYCVGPRAMPGLVPTSPEDPATEANRAAWKALCDST
TPMLVAFSDSDPITGAMAPIFSSQMRGAQGIDHPVIANAGHFLQEDAGVELAEAIVRFLA
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcagactttgcgcaccccggacgaacgctttgccaatctgcctgaattcccttatccc
gcaaagtattgcgaagtcgacgacggcgacggcgggcaattgcgggtggcatgggtggaa
gtcggtcccgccgaaggtaatccggtgctgatgctgcacggcgagccgtcatggtcgttt
ctctatcggaagatgatgccggtcttggccgccgccggttatcgggtcatttgtccggac
ctggtcggtttcggcaggtccgacaagcccacccggatcggggaccacgcgtatgcccgg
catgtcgagtggatgcgcgctgtcgcgttcgacgtgctcgacctgcagcacgtcacgctc
gtcgggcaggactggggtgggctgatcgggttacggatcgccgcggaaaatccggatcgg
ttcgcgcgcatcgtcgtcgccaacacaggactgcccacgggcgatcatccaatgcccgag
gtgtggtggaacttccgcaaggcgatccagggcgcatcccagctagacgttggccgctgg
gtcgaggccggctgcgcgcgcccgtttaccggcgcaatccgcgcggcctacagtgcgccg
ttccccgacgactcctattgcgtcggcccgcgggcgatgccggggctcgtgcccacctca
ccggaggacccggcgacggaggccaaccgcgctgcgtggaaagcgttgtgcgacagcaca
accccaatgctcgtggcattcagcgacagcgacccgatcaccggcgcgatggcgcccatc
ttctcgagccagatgcgcggcgcgcagggcatcgaccaccccgtcatcgcgaacgccggg
cacttcctgcaggaagacgccggcgtggagctcgcagaggcgattgtccgattcctcgcg
cgctag

DBGET integrated database retrieval system