KEGG   Mycobacterium sp. JS623: Mycsm_06095Help
Entry
Mycsm_06095       CDS       T02423                                 

Definition
(GenBank) conserved lipoprotein/antigen
  KO
K14953  ipoprotein LpqH
Organism
msa  Mycobacterium sp. JS623
Pathway
msa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:msa00001]
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    Mycsm_06095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Myco_19_kDa
Motif
Other DBs
NCBI-ProteinID: AGB26255
UniProt: L0J3W8
Position
6056441..6056902
Genome map
AA seq 153 aa AA seqDB search
MKRGFVVAVGGAAIVIAGLSGCGSGEKKSETSGQTSSAASAQGKTTVTIDGQDQKVQGTV
VCSSMGGNMNIAIGDAATGIAAVVSDDGKTVQSVGLGNVNGVTLGYQAGTGQGDAKAEKD
GKTWKISGTATGVDMANPMQPMNKPFAIEVSCP
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgtgggttcgtggtcgccgtaggcggcgcggcgattgtcattgccggtctttcc
ggctgtggttcgggtgagaagaagtccgagacaagcggccagacgtcctcggcggcgtca
gcgcaaggcaagaccaccgtcacgatcgatggacaggatcagaaggtccagggcacagtc
gtgtgcagctcaatgggcggaaacatgaacatcgcgatcggcgacgccgcgacaggcatc
gcggccgtggtgagcgatgacggcaagaccgtacagtcggtcggtttgggcaacgtcaac
ggtgtgacgctcggctatcaggccggtaccggccagggcgacgcgaaggccgaaaaagac
ggcaagacgtggaagatttcaggcaccgcgaccggcgttgacatggccaaccccatgcaa
ccgatgaacaagccgttcgcgattgaggtttcctgcccgtag

DBGET integrated database retrieval system