KEGG   Mycobacterium sp. JS623: Mycsm_06098Help
Entry
Mycsm_06098       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_17 MerR_1 MerR HTH_23 Phage_AlpA HTH_31
Motif
Other DBs
NCBI-ProteinID: AGB26258
UniProt: L0J5W4
Position
complement(6058140..6058877)
Genome map
AA seq 245 aa AA seqDB search
MGDSPGSIRAMARCGKCGHFASVHHGGGGGRPGGSSCAAPECDCPKFVEGADARVPLGKD
NLTPAEVAQLTGLSVHTLSYWRQTDQGPKTIKAGTRTLYRRKDLEQWLAGVDGRTEPLRS
NRNAPSESTSRTTGWYEKAVEAAGRIEPARASPWKLASTYALLSIAESLLAHRQKRPPGP
APTGSAGRQDSELLTVADVAEMTRIKTSTLRYWRALGERGPASFKLGRHVMYRRADVEKW
LNEAR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgacagccccggctcgatcagagcgatggcccgttgcggcaagtgcgggcacttc
gccagcgttcaccacggcggtgggggaggacgccccggcggctcgtcctgcgcggccccc
gagtgcgattgcccaaagtttgttgagggcgccgacgcccgcgttccgctgggcaaggac
aacctgacgcctgctgaagtggcacagctgacggggctgtcagtgcacaccctgagctat
tggcgtcaaaccgatcagggaccgaagacgatcaaggcaggcacccggacgctgtaccgg
cgaaaggacctagagcagtggctcgcaggagtcgacggacggacagaacccttgcgcagt
aacaggaatgcaccgtcagaatcgacatcgagaacgaccggctggtatgagaaggcggta
gaggctgcaggccggatcgagccagcccgcgcatcaccctggaagcttgcgagcacttac
gcactgctatccatcgccgaaagccttctcgcacaccggcagaagagaccgccgggtccg
gccccgacgggatccgcagggcgacaggatagcgaacttctcaccgtcgccgacgtagcc
gagatgacgcggatcaagacgagcacgttgcgctactggcgcgccctgggagagcgcggc
cctgcgtcgttcaagcttggcaggcatgtgatgtaccgccgtgcggatgtagagaaatgg
ctaaacgaggcgcgatga

DBGET integrated database retrieval system