KEGG   Mycobacterium sp. JS623: Mycsm_06099Help
Entry
Mycsm_06099       CDS       T02423                                 

Definition
(GenBank) Protein of unknown function (DUF2637)
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2637 HTH_23 HTH_28
Motif
Other DBs
NCBI-ProteinID: AGB26259
UniProt: L0J4P1
Position
complement(6058931..6059782)
Genome map
AA seq 283 aa AA seqDB search
MTTQAEITQKNHHRAVRFFWGLLLGATLVSLVGNEVHALLPYIPKVVIEIGAAAVPPIVL
LAAVHGIALAVRAGASGRVYRCATAAVAVIGMGAFMLSFRALRDLLIETGTPAEWAWVFP
AIIDTAVGVSTLMLVALGDKPARRARTVTSSTGTQTPAKQRLAQPPTQNAKGEVTPFAPA
SARAQTSASVQPDPAQTMGDSAQVEVTEADAERAQVDANLASELIASGVTTQAVETVIAV
LAARRNGASINAAAKGSGINYRTAQRIVQAAAENRQRELAVAS
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccaggccgagatcacccagaagaaccaccaccgcgccgtccgcttcttctgg
ggccttctgctgggtgcgacacttgtgagtctcgtcggcaacgaggtccacgcattgctg
ccgtacatccccaaggtcgtcatcgagattggcgccgcagctgtgccccccatcgtcctc
ctcgccgccgtgcacggcatcgctctcgccgtccgtgctggagcgtccggcagggtctac
cgctgcgctaccgcggcagttgcagtcatcggcatgggcgccttcatgctcagcttccgc
gcgctccgtgacctgctgatcgagacgggcacgccagcggaatgggcgtgggttttccct
gccatcatcgacaccgcggtcggagtgtccaccctgatgttggttgcgctcggggacaaa
ccggcacgccgcgcccgcaccgtaacctcgtctaccggtacacaaactccagccaagcaa
cggttggcgcaaccccccactcagaatgcaaaaggcgaggtcacaccgtttgccccagcc
agtgcgcgagcgcagacctctgcatcagtacaacctgacccggcacagacaatgggggac
tcagcgcaagtcgaagtgacagaggccgatgcagaacgtgcacaggttgatgcaaacctt
gcgtcggagctgattgcatccggtgtgaccacacaagctgtcgagactgtgatcgcggtt
cttgcggcacgacgcaacggcgcgtcgatcaacgctgccgccaagggatctgggatcaat
tacaggactgcgcagcggatcgtgcaggcggcggccgagaaccgacagcgggagcttgcg
gtggccagctga

DBGET integrated database retrieval system