KEGG   Mycobacterium sp. JS623: Mycsm_06113Help
Entry
Mycsm_06113       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BTP
Motif
Other DBs
NCBI-ProteinID: AGB26272
UniProt: L0J6N8
Position
6077929..6078165
Genome map
AA seq 78 aa AA seqDB search
MNLKAAMITGVMIVIGVTCWTFWYNSQDQKLQRCITADQQEWEIKVRTDPQAQMIHNAGG
DPPLTLALLDCDDKLGIK
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgaaggcagcaatgatcaccggtgtgatgatcgtcatcggtgtcacatgttgg
acgttttggtacaactcgcaagaccaaaagctgcagcgatgcatcacagccgatcagcag
gagtgggagatcaaggtacggaccgacccacaggctcagatgattcacaacgcaggtggg
gatccgccactcacgctcgccctgctcgactgcgacgacaagttggggatcaagtga

DBGET integrated database retrieval system