KEGG   Mycobacterium sp. JS623: Mycsm_06115Help
Entry
Mycsm_06115       CDS       T02423                                 

Definition
(GenBank) Protein of unknown function (DUF732)
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF732
Motif
Other DBs
NCBI-ProteinID: AGB26274
UniProt: L0J4Q7
Position
6078527..6078853
Genome map
AA seq 108 aa AA seqDB search
MRASIPAVASVSFSLILAATASADTDDEVFLQKLANDGIREFPHPLVQEGHSICHTIDLG
PSGGGYVPDVLDRMSQTFHQWLTHQQTADLVVDSVLAYCPYDRDKLNF
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgagcatccctgcagtcgcctcagtctctttctccctgatcctggcagcgacg
gcgagtgcggatacggatgacgaagttttcctacagaaactggctaatgacgggatccga
gagttcccgcacccactggtccaggagggtcacagcatctgccacaccatcgatctcggc
ccgagcggtggggggtatgtgccggatgtgctcgaccgaatgtcccagacgtttcaccag
tggctaacacaccagcagacagctgatctggtggtcgactccgtcttggcgtactgccca
tacgaccgcgacaaactgaacttctga

DBGET integrated database retrieval system