KEGG   Mycobacterium sp. JS623: Mycsm_06119Help
Entry
Mycsm_06119       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T7SS_ESX_EspC
Motif
Other DBs
NCBI-ProteinID: AGB26278
UniProt: L0J5Z7
Position
6079960..6080340
Genome map
AA seq 126 aa AA seqDB search
MVDEGNPNCDHRFPRGSEWCAICGRYRHADQVKELVAKAPPLSQDQINRISLIFRSTAKD
IDWAAVAAEGAMADVIQQHGLVRYPVECACGENLRRPQDWGRHVAGAIYQTLEAAGVKRK
RRTAQR
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggttgacgaaggaaaccccaactgcgaccaccgatttccccgcggcagcgagtggtgt
gccatttgcgggcgctaccgccacgccgaccaagtcaaagagctggtcgcaaaggccccg
ccgctcagccaggatcagatcaaccggatctcactgatattcaggagcacggcgaaagat
atcgactgggccgcggtcgccgccgagggcgccatggccgacgtcatccagcagcacggc
ctggtgcgctaccccgtcgaatgcgcgtgcggcgagaacctccgtcggccccaggattgg
ggacgccatgtcgctggagcgatctaccagaccctggaggcggctggcgtcaagcgcaag
cgccgaaccgcccagcgatga

DBGET integrated database retrieval system