KEGG   Mycobacterium sp. JS623: Mycsm_06124Help
Entry
Mycsm_06124       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YlzJ
Motif
Other DBs
NCBI-ProteinID: AGB26283
UniProt: L0J606
Position
complement(6081405..6081650)
Genome map
AA seq 81 aa AA seqDB search
MNGNSNSNDDKGAGQIAMTDDLFGWPGDGVHWAWQRCGRCEYRKVRVHSTNPDHLVRRAA
SPTNVSPVQIADRYAAGRRHG
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggaactcgaactccaacgatgacaagggcgcgggccagatcgccatgacagac
gacttgttcgggtggcctggtgacggcgtgcactgggcgtggcagcggtgtggccgctgc
gaataccggaaggtccgggtgcactcgaccaaccccgaccacctggttcgccgcgcggcg
tcgccgacgaatgtctcgcccgtgcagatcgccgaccggtacgcggccgggcgcaggcat
ggctga

DBGET integrated database retrieval system