KEGG   Mycobacterium sp. JS623: Mycsm_06128Help
Entry
Mycsm_06128       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGB26287
UniProt: L0J6S8
Position
complement(6086286..6086774)
Genome map
AA seq 162 aa AA seqDB search
MANRPAVNPNVHDIADQAKHGYATGTKLLAETQYRLGELAGTGRLDLDESISMQTQLFYI
WGALYAGTLCAVRDEDADDCTWDEADNTYSDGRHVRIQIRIEPEAASDFTWEHNRFVLGD
GAVAEHPLGTICYIAPINPHDDQPVDLGDEADSADSDGEHEI
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccgacccgcggtgaatccaaacgttcacgacatcgccgaccaagcgaaacac
ggttacgccacaggcacgaaactgctcgctgaaacgcagtaccggctcggtgaactagca
ggcaccggtcggctcgacctcgacgagtcgataagcatgcagacgcagctcttctacatc
tggggggccctgtatgccggcacactatgcgcggtgcgtgacgaggacgccgacgactgc
acctgggatgaggccgacaacacgtacagcgacggtcgccacgtcagaatccagattcgg
atcgagcccgaggcggcctcggacttcacctgggagcacaaccgcttcgtgctgggcgac
ggtgccgtcgccgaacacccgctcgggacgatctgctacatcgcgcccatcaatccccac
gacgatcaacccgtcgacttgggcgatgaagcggactccgctgacagcgatggagagcac
gaaatctag

DBGET integrated database retrieval system