KEGG   Mycobacterium sp. JS623: Mycsm_06130Help
Entry
Mycsm_06130       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_17
Motif
Other DBs
NCBI-ProteinID: AGB26289
UniProt: L0J4U1
Position
complement(6087306..6087581)
Genome map
AA seq 91 aa AA seqDB search
MAIQDLTDTELSRLFVDTGIDLSTLPAIATSRELAPVMATTEAALAQDRYRRGGIPYVKF
GRRVRYLRADVARYLAANRSDNPPGAASRSK
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atggcaatacaagacctgacggacaccgagttgtcgaggctgttcgttgacaccggcatc
gacttgtcgacactccccgccatcgcgacgtcgcgcgagttggcgcccgtaatggcgacc
accgaagccgcgctcgcccaggacaggtatcggcgcggcggcattccctatgtgaaattc
ggcaggcgtgtgcgttatctgcgcgccgatgtggctcgttacctggccgcgaaccgcagc
gacaacccgccgggggccgcctcgagatcgaagtaa

DBGET integrated database retrieval system