KEGG   Mycobacterium sp. JS623: Mycsm_06137Help
Entry
Mycsm_06137       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
  KO
K09957  uncharacterized protein
Organism
msa  Mycobacterium sp. JS623
Brite
KEGG Orthology (KO) [BR:msa00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Mycsm_06137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycolipid_bind
Motif
Other DBs
NCBI-ProteinID: AGB26295
UniProt: L0J436
Position
complement(6091658..6092254)
Genome map
AA seq 198 aa AA seqDB search
MSEGRSEDKDGAWPRILTWRAHDVPRMESVRVQLSGNRMKAYGRIVAAATPSHPAFSASY
DLVTDEAGATKRLSLTVTLAERERQLSIARDEENMWLVQHHTGESRRAAYEGALDVDLIF
SPFFNALPIRRTGLYQRSESVTLPVVYVRLPELSVDPAVISYSSAPDGIKLHSPVAETTI
RVDDEGFILDYPGLAARI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaggtcgctctgaagacaaggacggcgcctggccgcgaatcttgacctggcgc
gcgcatgatgtaccgcggatggagtccgtgcgggttcagctgtccggcaaccgcatgaag
gcatacggcaggatcgtcgcggccgcgacgccgtcgcacccagccttctcggcttcctat
gatctggtcaccgatgaggcgggcgccacgaaacgcctgtcgctgaccgtcacgcttgcc
gagcgcgagcggcagctgtcgatcgcccgcgacgaagagaacatgtggctggttcagcat
cacaccggcgagtccagacgtgccgcctatgaaggcgcgctcgacgtcgatctgatcttc
agcccgtttttcaacgcgctgccgatccggcgcaccgggctctatcagcgcagcgagtcg
gtgacgttgcctgtggtctacgtgcgtttgcccgagctgtcggtggacccggcggtcatc
agctacagcagcgcgcccgacgggatcaagctgcattcaccggtggcagagaccacgatc
cgggtcgacgacgagggcttcatcctcgactacccagggttggcagcgcggatctga

DBGET integrated database retrieval system