KEGG   Mycobacterium sp. JS623: Mycsm_06138Help
Entry
Mycsm_06138       CDS       T02423                                 

Definition
(GenBank) ABC-type proline/glycine betaine transport system, permease component
  KO
K05846  osmoprotectant transport system permease protein
Organism
msa  Mycobacterium sp. JS623
Pathway
msa02010  ABC transporters
Module
msa_M00209  Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:msa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Mycsm_06138
Transporters [BR:msa02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    Mycsm_06138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 QCR10
Motif
Other DBs
NCBI-ProteinID: AGB26296
UniProt: L0J7M3
Position
complement(6092251..6093030)
Genome map
AA seq 259 aa AA seqDB search
MNFLQQALSYIFTAANWGGAAGLTARILEHLQYTVVAVVFSAIIAAPLGMIIGHTGRGTF
LVVTGVNALRALPTLGVLLLGVLLWGLGLVPPTVALMLLGIPPLLAGTYSGIANVDRAVV
DAARSMGMTETRVLLRVEVPNAMPLILGGLRTATLQIVATATVAAYASLGGLGRYLIDGI
KVRQFYLALVGALMVTALALILDAALAFAVWASVPGTGRLRQMPQPLLGDEVVLESRAPA
QSTSIRRYERGDPSPTVEG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcttgcagcaagcactttcgtacatcttcaccgcagccaactggggtggtgcc
gccggcctgacggcgcgcattctcgagcacctgcaatacaccgtcgtcgccgtcgtcttc
tcggccatcatcgctgcgccactgggcatgatcatcgggcacaccggccgcggcaccttc
ctcgtcgtgaccggggtcaacgcgcttcgcgcactgcctacgctcggtgtgctgttgctg
ggtgtgctgctgtggggcctcgggctggtgccgccgaccgtggcgctgatgttgctgggc
atcccgccgctattggccggaacctactcgggcatcgccaatgtggaccgcgccgtcgta
gacgccgcgcgttcgatgggcatgaccgagacgcgggtgctgctgcgcgtggaagtaccc
aacgcgatgccgctgatcctcggcgggttgcgcacggcgacactgcagatcgtcgccacc
gcgaccgtcgcggcctacgcgagcctgggcggcctgggtcgctatctgatcgacggcatc
aaggtgcggcagttctatctcgcattggtcggcgcgttgatggtcacggccctggcgttg
atcctcgacgcggcgctggctttcgccgtgtgggcgtcggttcccggcaccggccggctg
cgtcagatgccgcagccgttgctcggcgatgaggtcgtcctcgagtcgcgagcacccgcg
caaagcacttcaatacggcgctacgaacgaggcgatccttcgcctacggtagaggggtga

DBGET integrated database retrieval system