KEGG   Mycobacterium sp. JS623: Mycsm_06141Help
Entry
Mycsm_06141       CDS       T02423                                 

Definition
(GenBank) periplasmic glycine betaine/choline-binding (lipo)protein of an ABC-type transport system (osmoprotectant binding protein)
  KO
K05845  osmoprotectant transport system substrate-binding protein
Organism
msa  Mycobacterium sp. JS623
Pathway
msa02010  ABC transporters
Module
msa_M00209  Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:msa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Mycsm_06141
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:msa02000]
    Mycsm_06141
Transporters [BR:msa02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    Mycsm_06141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OpuAC
Motif
Other DBs
NCBI-ProteinID: AGB26299
UniProt: L0J4U9
Position
complement(6094828..6095769)
Genome map
AA seq 313 aa AA seqDB search
MSSTRTSILAVIAAVLALVIAGCGSSNPLGGGEVSGDLKSIKVGSADFTESKIIAELYAQ
ALEANGFTVRRQFGIGSRETYIPAVQDHSIDLIPEYTGNLLQYFDKQATATTSDAVLLAL
LKALPGDLSILYPSPAEDKDTLAVAEATAQKWNLKTIADLAAHSPEVKVGAPSEFQTRVT
GLVGLKDKYGLDIAPANFIAISDGGGPATVQALTSGAITAANVFSTSPAIEQSHLVVLED
PKNVFLAANVVPLVASQKMSAELKTVLDAVSAKLTTEGLIQLNTAVEGNKGIDPDKAAQK
WIKDNGFDKPLQK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcacgcgtacatcgattctggcggtcattgcggcggtgcttgcgctggtgatc
gccgggtgcggcagctccaatccgctcggcggcggggaggtatccggagatctcaagtcg
atcaaggtcggttcggccgacttcaccgagtcgaagatcattgccgagctctacgcccag
gcgttggaggccaacggcttcaccgtccgccgtcagttcggcatcggcagccgcgaaacg
tatatccctgcggtgcaagaccattccatcgacctgatcccggagtacaccggcaacctc
cttcagtacttcgacaagcaggcgacggcgacgacgtctgatgccgtgctgctggctctg
ctcaaagcgcttcccggcgacctgtcgatcttgtatccgtcgccggcggaggacaaggac
accctggcggttgccgaggcgaccgcgcagaagtggaatctcaaaaccatcgccgacctc
gccgcgcattcacccgaggtgaaagtcggcgcgccatcggaatttcagacccgcgtgacc
ggcctcgtcggtctcaaggacaaatacggtctggacatcgcgcctgccaacttcatcgcg
atcagtgacggcggcggacccgcgaccgtgcaagccctgacgagcggagccatcaccgcg
gccaacgtcttcagcacctcaccggcgatcgagcagagtcaccttgtggttctcgaggat
ccgaagaatgtgttcctcgcggcgaacgtggtgccactggtggcgtcgcagaagatgtcc
gctgagctcaagacggtactggacgccgtcagcgcaaaactgaccacggagggtctgatt
cagctcaacacggcggtggaaggcaacaagggcatcgaccccgacaaggcggcgcaaaag
tggatcaaggacaacggcttcgacaagcccctgcagaaatag

DBGET integrated database retrieval system