KEGG   Mycobacterium sp. JS623: Mycsm_06144Help
Entry
Mycsm_06144       CDS       T02423                                 

Definition
(GenBank) fructose-2,6-bisphosphatase
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AGB26302
UniProt: L0J6U1
Position
complement(6097335..6097943)
Genome map
AA seq 202 aa AA seqDB search
MQLLLIRHALPLRSEPGQGSDPDLSEEGIEQAKRLPDALARFPITRLVSSPQVRSIQTAQ
PVADALRLTIEVDDRLAEYDRDMADYIPIEQIAAEFPEELARLSQGHLPSSVDETAFLDR
INAGIRAIAEAGDHEDTVAVFTHGGVINGLVHTIMGTEKILCVNVDYAGITRLLLSREGN
LYVASLNGTEHVWDLLPRNQRW
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgcaattgcttctcatcaggcatgcgctgccgcttcgcagcgaacccggacagggctct
gaccccgatttgtccgaagagggcatcgagcaggccaagcggctgcctgatgcgctggcg
cgcttcccgatcacccggctggtaagcagcccgcaggtccggtccatccagaccgcgcaa
cccgtcgccgacgcgctgcggctgacaatagaggtcgacgaccggctcgccgaatacgac
cgcgacatggcggactacatcccgatcgagcagatcgccgccgaatttcctgaggagctg
gcccggttgtcgcaggggcatctgcccagcagcgtcgacgagaccgcgttccttgatcgg
atcaacgccgggatccgggcgatcgcggaagccggcgatcacgaggacaccgtcgcagtg
ttcacccacggcggcgtgatcaacggactggtgcacaccatcatgggcaccgagaagatc
ctgtgcgtcaacgtcgactacgccgggatcacccggctgctgttgtcccgcgaaggcaat
ctgtacgtcgcgtccctcaatggcaccgagcacgtatgggacctcttgccgcgaaaccag
cgatggtag

DBGET integrated database retrieval system