KEGG   Mycobacterium sp. JS623: Mycsm_06145Help
Entry
Mycsm_06145       CDS       T02423                                 

Definition
(GenBank) dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AGB26303
UniProt: L0J622
Position
6097961..6098731
Genome map
AA seq 256 aa AA seqDB search
MTSRGYADHLFDLTDRVVLVTGGSRGLGREMAFAAAHCGADVIIASRKYETCVETVKEIE
AATGRAALPYQVHVGHWDEIDGLVAAAYERFGKVDVLINNAGMSPLYESLSTVTEKLFDS
VINLNLKGPFRLSALVGERMVADGGGSIINVSSSGSRRPRPEQLPYSAAKAGLNALTEGL
ALAFGPTVRVNTLMPGPFLTDISKAWDIPATTKGAQHFALKRLGNPPEIIGAALFLASDA
SSYTSGSIIRVDGGIP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
gtgacttcccggggatacgccgaccacctcttcgatctcactgaccgggttgtgctggtc
accggcggcagccggggcctcggccgggagatggcgttcgccgcggcgcactgcggcgcc
gacgtgatcatcgccagccgcaagtacgagacgtgcgtcgagaccgtcaaggagatcgag
gccgcgaccggtcgtgccgcgctgccgtaccaggtgcatgtcggacattgggacgagatc
gacgggttggtggccgccgcctacgaacggtttggcaaggtcgacgtcctcatcaacaac
gctggcatgtcgccgctgtacgagtcactgagcacggtcaccgagaagctgttcgactcc
gtcatcaacctcaacctgaagggcccattccgattgtcggcccttgtcggcgagcgaatg
gtggccgacggcggcgggtcgatcatcaatgtcagctccagcgggtcgcgacggccccgg
cccgagcagctgccgtactcagcggccaaggcgggactgaacgcgctgaccgaagggctc
gcgctggcgttcggcccgaccgtgcgggtcaacacgttgatgcccgggccgttcctgacc
gatatcagcaaggcctgggacattccggcgacgacgaagggtgcccagcacttcgcgctc
aagcggctgggcaatccgcccgaaatcatcggtgctgctttgtttttggcctccgatgcg
tcgagctacaccagcggttcgatcatccgcgtcgacggcggcattccctag

DBGET integrated database retrieval system