KEGG   Mycobacterium sp. JS623: Mycsm_06152Help
Entry
Mycsm_06152       CDS       T02423                                 

Definition
(GenBank) RNA polymerase sigma factor, sigma-70 family
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
msa  Mycobacterium sp. JS623
Brite
KEGG Orthology (KO) [BR:msa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:msa03021]
    Mycsm_06152
Transcription machinery [BR:msa03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Mycsm_06152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 Sigma70_r4 Sigma70_r2 Sigma70_ECF
Motif
Other DBs
NCBI-ProteinID: AGB26310
UniProt: L0J450
Position
complement(6102894..6103391)
Genome map
AA seq 165 aa AA seqDB search
MTGAAYADWDAVYRDNVTWVYRLMYGKVGNQPDAEDLTAEVFMTALRPLRVSATVPEVRK
YLRMTARTALASYWGDRMGRQVTVIEDDVPEPIEPELVASDAPDKVRQLLQRLPDNYRRI
LELRFLQAFSVREAASQMGVTVANAKVLQHRALRMAAQSGEEATT
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggggcggcgtacgcggattgggacgcggtgtatcgcgacaacgtcacctgggtc
taccggctgatgtacggcaaagtcggcaaccaaccggacgccgaagacctgactgcggaa
gtgttcatgacggcgctgcgcccgctgcgagtctccgcgaccgtacctgaggtacgcaag
tatcttcggatgacggcccgcacggcgctcgcgtcctactggggcgatcggatgggccgc
caggtgaccgtcatcgaggacgacgtgcctgagcccatcgagccggagttggtcgcaagc
gatgcgcctgacaaggtgcgccagctgttgcagcggctgccggacaactaccgtcgcatc
ctggaactgcgtttcttgcaagccttttcggtgcgtgaggccgccagtcagatgggggtg
accgtggcgaacgcgaaggtgttgcagcaccgcgcgctgcggatggcggcacaatcgggt
gaggaggccacgacgtga

DBGET integrated database retrieval system