KEGG   Mycobacterium sp. JS623: Mycsm_06153Help
Entry
Mycsm_06153       CDS       T02423                                 

Definition
(GenBank) family 3 adenylate cyclase
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Guanylate_cyc Hydrolase_4 Abhydrolase_6 Abhydrolase_4 Ndr Esterase
Motif
Other DBs
NCBI-ProteinID: AGB26311
UniProt: L0J7N7
Position
6103596..6104966
Genome map
AA seq 456 aa AA seqDB search
MAHAPQTHYAKGPGGDIAYQVVGDGPMDLVIVPGWLSHVDLMWADPSWAKFVGELASFAR
VILYDKRGTGLSDPVDGVPTLESRADDLRAVLDAAGSDRAALFGYSEGGPISVMFAATYP
GRVLSLILFGTYANGSRDDDGSPGRAKWIELMDRVEASLDCWGEGLTLDWAAPSLRHSTM
QRTGCGALERAAMSPKMARLTFEAVLTKAKVQDILHSVSVPTLVLHRTDEAIPVEFAREI
AEKIPTARLVELEGVDHWAAVGDIKSITGEVEQFLTGHRHAQPPDRVLATVLFTDIVDST
RRAAELGDRGWRELLGRHDDLTREQIGRFQGREVKHTGDGFLATFDGPTRAVRCATTLAE
RMPEIGVEIRSGLHTGECEVRGDDIGGIAVHIGARIAALAKRREVLVSRTVKDLVNGSGI
TFEDRGSHVLKGIPAEWQLYSPVGEHDPAEGLLARN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggctcacgcgcctcagacgcattacgcgaagggcccggggggagacatcgcctatcag
gtggtcggcgacggtccgatggatctggtaatcgtcccgggctggctctcccacgtagat
ctgatgtgggcggatcccagctgggcgaagtttgtcggagaacttgcatcgtttgcccgc
gtgatcctctatgacaaacgcggcactggtctttctgatcccgtcgatggcgtgccaacc
ctcgagagccgcgccgatgacctgcgtgcggtactggacgctgcgggcagcgatcgcgcc
gccctgttcggatactccgagggtgggcccatcagcgtgatgttcgccgctacgtatccg
ggccgggtgctgtcgctgattctcttcggcacatacgcaaacggatcgcgcgacgacgac
ggctcaccgggccgggcgaaatggatcgagctgatggaccgggttgaggcgtcgctcgac
tgttggggcgagggactgacgttggactgggcggcgcccagcctcaggcacagcacgatg
cagcggaccggctgcggcgcactggaacgggctgccatgagcccgaagatggctcggctg
acgtttgaggcggtgctcaccaaggccaaagtccaggacatcctgcacagtgtttcggtg
cctacgctggttctgcatcgcaccgacgaggcgatcccggtggaattcgcgcgggagatc
gccgagaaaattccgacggcgcggcttgtcgaactcgaaggggtcgaccactgggcggcc
gtcggggatatcaagtcgatcaccggtgaggtcgagcagtttcttacgggccaccgtcac
gcgcaaccgccagaccgagtgctggccaccgtgctgttcaccgacatcgtcgattcgacg
cgccgcgcagccgaactcggtgaccgcggctggcgcgaactgctcgggcgacacgatgac
ctaacccgcgagcagatcggccgcttccagggccgcgaggtcaagcacaccggcgacggg
ttcctggcgaccttcgacggaccaacccgagctgtccggtgcgccaccacgctcgctgag
cgcatgccggaaatcggcgtcgagatccgcagcggtctgcacaccggcgaatgtgaggta
cgcggcgacgatatcggcggcatcgccgtacacatcggggcacggatcgccgcgttagcc
aaacgtcgagaggttcttgtttcccggaccgtcaaggacctcgtcaacggctccggcatc
acgttcgaagaccgtggctcccatgtgctgaagggcattccggccgaatggcagctgtat
tcccctgtcggggaacatgatccggccgaggggttgttggcccgaaactga

DBGET integrated database retrieval system