KEGG   Mycobacterium sp. JS623: Mycsm_06154Help
Entry
Mycsm_06154       CDS       T02423                                 

Definition
(GenBank) transcriptional regulator, luxR family
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerE AAA_16 TPR_12 TPR_19 Sigma70_r4_2 AAA_22 HTH_23 TPR_21 HTH_38 HTH_24
Motif
Other DBs
NCBI-ProteinID: AGB26312
UniProt: L0J6V0
Position
6105104..6107824
Genome map
AA seq 906 aa AA seqDB search
MSDFLGSAAVQPSGQIIAGEAGIGKTTLWLDGLAQAREQGFQVLSARVGQAESVMAYAAV
ADLVGDVDTAVFDALPDLQRLALDRVLLRAGGAGPETNHRVTAAALVEVVDLLARDRPVL
VAVDDVQWLDSSSRAVFSYAAKRFRGRVGVLVTERTQSDAGTSASWLQLGDPSRLARIQL
GPLSLSAMQALISERLGQTFPRPTMVRIAEVSGGNPFYALELAREMGGRHTDAKALPRTL
ADLVQGRIGRLTDETRNALLVAASVSDPTVDVLARATETTTERVVELLEEPEDHGIVVVE
GNRVRFTHPLLARGVYTDAAPARRRRVHRALADVVTHPELHARHLALATSSHDPRTLEAL
DIAAKAARHRGAPSAAAELLELAIMLGGDTPARRLRVAEHNVRGGDTKHAEAVLDPLIEQ
MPAGPERAEARLVRSTIYLNSDRYRPAVKDLKLAIEDSRDNLVMLAQVRLMLSFAQARMA
RLDEALKNARQARAEAEQTKIPVLVSSALANWVFVSFMAGLGFDEPSMQRALELEDFNTE
VAISCRASAVNAVVLTWTGRLEEAAAQMEAVRSRHLERGADTEMLFVSLNSTLLNLLRGN
YRDAERDAADTLERTERVGGESFRRSTGLAIRGAIAVATGREAEARADLYSALEAGLRSQ
SPMIGFVAAMLTALEVSLGNYEQALEVSQPLLANFDAIPGTEVNTSAYLPDAIEALVTTG
RLDDAIPFIEALETNGRRFDRAWMLAVGARCRSMLLAARGDVTAAVSMAEQAMAEHERLP
IPLERARTQLLLGQLQRRQRKKQTAAATLTEALETFERLGNPLWVARARAELERTNVSPG
KGPELTPTERRVAELAATGITNRDIAAELFVSVKTVEANMSRIYRKLGIRSRAELGRRID
GESQSG
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggatttcctcggttcagccgctgtgcagccgtcgggtcagatcatcgccggggaa
gccggcatcggtaagacgacgctgtggctcgacggattagcgcaagcgcgcgagcaagga
ttccaggtgctgtcggcgcgtgtcggccaagcggagtcggtgatggcgtacgcggcggtg
gctgacctcgtaggtgacgtcgacacagcggtgttcgacgccctgcccgaccttcaacgc
ctcgcgctcgaccgggtgttgttacgggcaggcggtgcgggtccggaaaccaatcatcgc
gtcactgcggcggccctcgtggaggtcgtggacctgctcgcgagagacaggcccgtgctg
gttgccgttgacgatgtgcagtggctggactcgtcgagccgagcggtgttctcgtacgcg
gcgaagcggtttcgcggacgagtcggcgtgctggtaacggaacggacgcaatcagacgcc
ggtaccagcgcgtcgtggctgcagctgggcgatcccagccgactggctcgcatccagctc
ggtccactgagtctgagcgcgatgcaagcattgatttccgaacgcctcggccagaccttc
ccgcgtcccaccatggtgcgcatcgccgaggtgtccggtggaaatcctttctacgccctg
gaattagcgcgcgagatgggcggccgtcacactgacgccaaagctctgccccggacactg
gccgatttggtgcaggggcgtatcgggcgccttaccgacgaaacccgcaacgcgctgctt
gtcgcggcgagcgtgtcggatccgacggtggatgtccttgcccgagcgacggagacgacc
accgagcgagtggtggaactgcttgaagaacccgaagaccacggcatcgtggtggtcgaa
ggcaaccgcgtccggttcacccacccgctgttggcgcgaggcgtttacaccgacgccgca
ccggctcgtcgccgccgcgttcatcgcgcactggccgacgtggtgacccatccggaactt
cacgcgcgacatctggccttggccacgtccagccacgaccctcgcactctcgaggccctc
gacatcgccgccaaggctgcccgacaccggggcgcgccgtcggcagcagcggagcttctc
gaacttgccatcatgctgggcggtgatacgccggcacggcgcctgcgggtggccgagcac
aacgtcaggggcggcgacaccaaacatgctgaagcggtgctcgacccgttgatcgagcag
atgccggcaggacccgaacgcgcagaggcacgcttggtgcgctcgaccatctatctcaac
tccgatcgctaccggccggcggtcaaggacttgaagctggcaatcgaggactccagggac
aacctcgtcatgctcgcgcaggtccggctgatgctgtcattcgcccaggcccggatggcg
cggcttgacgaagcgcttaaaaacgcgcggcaagcgcgcgccgaggcggagcagaccaag
attcccgtgctggtcagttcggccctagccaattgggtgttcgtgagtttcatggccggc
cttggatttgacgagccaagcatgcagcgcgcactcgaactggaggacttcaacaccgag
gtcgcgatttcatgccgtgcgagtgcagtgaacgccgtcgtgctgacctggacgggtcga
ctcgaggaagcggcggcgcagatggaggccgttcgcagtcgacatctcgaacgcggcgct
gacaccgagatgcttttcgtgtcattgaattccacgctgctgaatctcttgcgtgggaac
taccgagatgcggaacgcgacgcagcggacaccctagagcgcacggagcgggtcggcggg
gagagcttcagacgaagcaccggtctcgctatccgcggcgccatcgcggtggccaccggt
cgcgaggccgaggccagggctgacttgtactcggcgttggaagcgggactgcgaagccaa
tccccgatgatcggcttcgttgccgcgatgttgacggcactggaggtgtccctgggcaat
tacgaacaggcgcttgaggtttcgcaaccgctgctggcgaatttcgatgccattcccggc
accgaggtcaatacgtctgcctacctgcccgacgcaatcgaggcgttggtgacgacgggc
aggctcgacgacgcgatcccgttcatcgaagcgctggaaaccaacggccgccggttcgac
cgggcatggatgctggcggtgggtgcgcggtgtcgcagcatgctgctggcggcgcggggc
gatgtcacagcggcagtcagcatggccgagcaggcgatggccgagcacgagcgattgccg
atccccctcgaacgcgctcgaacccagctgctgctgggccagctgcagcgtcgacaacga
aagaagcagaccgccgcagccaccctgaccgaagcgctggagacattcgaacggttgggc
aacccgctgtgggtggcgcgcgcacgcgccgagctggaacgcaccaacgtcagccccggc
aagggaccggagctcacgccgacggagcgacgggtcgctgagttggcggcgacgggcatc
acgaaccgcgacattgccgccgaattgttcgtcagcgtgaaaacggtggaggccaatatg
tcccggatctaccgcaagctcggcatccgatcgcgtgccgaactcggccgacgaatcgac
ggagaatcgcaaagcgggtga

DBGET integrated database retrieval system