KEGG   Mycobacterium sp. JS623: Mycsm_06167Help
Entry
Mycsm_06167       CDS       T02423                                 

Definition
(GenBank) cysteine desulfurase family protein, VC1184 subfamily
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGB26321
UniProt: L0J7P6
Position
complement(6114760..6115956)
Genome map
AA seq 398 aa AA seqDB search
MAYDVARVRGLHPSLGDGWVHFDAQNGMLLPDTVGRAVSTAFRGSMPTPVGPHPAAQRSA
AVLEAARQAVADLVGADPRGVVLGSDRAVLLTSLADASSSRVGLGYEVVVTRLDDEANIA
PWLRAANRYGAKVKWAEVDIETGELPTWQWEGLISRSTRLVAISSASSTLGTVTDLRAVT
KLVHDGGGLVVVDHSAAAPYRLIDIDEIDADVVAVNAVAWGGPPIGALVFREPSLIDSFS
SVSLNPYATGPARLEVGTHQFGLLAGVVASIEYLAGLDESARGSRRERLSLSMQSASTYM
NRVFDYLLASLRSLSTVMVIGRPETHIPVLSFAVNEVPAERVVQRLADNGILAVSNVSSR
VLDVIGVNDVGGAVTVGLAHYTTTAEVDQLVRALASLG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgacgtcgcccgggtgcgcggtctgcacccgtcattgggcgatggttgggtg
catttcgacgcccagaacggcatgctgctgcccgacacggtcggccgtgcagtgtccacc
gcattccgtggttcgatgccgacgcccgtggggccgcatcctgccgcgcaacgcagcgca
gcggtgctggaggctgcgcgccaggcggtggccgatctggtgggcgcggacccgcggggc
gtggttctcggctccgaccgcgcggtgctgctgacatcgctggccgatgcgtcgtcgtct
cgggtcggtcttggctacgaggtggtggtgacccgcctcgacgacgaggcgaacatcgca
ccgtggttgcgcgcggcgaatcgctatggcgccaaagtgaagtgggccgaagtcgacatc
gaaaccggtgaactgccgacctggcagtgggagggtctgatctcgcggtcgacccggctg
gtcgcgatttcgtccgcgtcctcgacgctgggcacggtgacagatctgcgggcggtgacg
aagttggtgcatgacggcggcgggttggtcgtcgtcgatcactctgcggcagcgccctac
cggctgatcgacattgacgagatcgacgccgacgtggtggcggtgaacgcagtggcatgg
ggtggcccgccgatcggtgcgctggtgttccgcgagccctcgctcatcgactcgttcagc
tcggtttcgcttaacccgtatgccaccggtcccgcgcgactcgaggtgggcacgcaccaa
ttcggcttgctcgcaggcgttgtcgccagcatcgagtatctggcgggtctggatgagtcg
gcgcgcggctcgcggcgcgaacgactttcgctctcaatgcaatccgcgtcgacgtacatg
aaccgggtgttcgactacctgctggcctcgcttcggtccctgtccacggtgatggtgatc
ggacggcccgagacgcatattccggtgctgagcttcgcggtgaatgaggtgcctgcagaa
cgtgtggtgcaacggctggccgacaacggcatccttgccgtctctaatgtcagctcgcgc
gtgctagatgtcatcggcgtcaacgacgttggcggtgccgtcaccgtcggtttggcgcac
tacacgacgaccgcggaggtcgatcagttggtgcgcgcgctcgcgtcgcttggctga

DBGET integrated database retrieval system