KEGG   Mycobacterium sp. JS623: Mycsm_06176Help
Entry
Mycsm_06176       CDS       T02423                                 

Definition
(GenBank) putative membrane protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GtrA
Motif
Other DBs
NCBI-ProteinID: AGB26330
UniProt: L0J467
Position
6124037..6124435
Genome map
AA seq 132 aa AA seqDB search
MSPNLTLKTQAWRFIVTGGFSAIVDFGLYVLLYKAVGLQVDLAKALSFIVGTITAYLINR
RWTFQAEPSTARFIAVMTLYGITFAVQVGLNHYCLHLFDYRTWAVPVAFVIAQGTATVIN
FIVQRAVIFRLR
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgaacctgacgctgaaaacccaggcgtggcggttcatcgtcaccggcgggttc
tccgccatcgtcgacttcggcctttacgtgctgctgtacaaggcggtcggcctgcaggtc
gacctggccaaggcactcagcttcatcgtcggcacgatcaccgcgtacctgatcaaccgg
cgatggacgttccaggccgaacccagcacggcccggttcatcgcggtcatgacgctgtac
ggaatcacgttcgccgtgcaggtcggcctcaaccattactgcctgcatctgttcgattac
cggacgtgggcggtgccggtggcgttcgtgatcgcccagggcaccgcgactgtgatcaac
ttcatcgtccagcgggcggtcatattccggctgcgctga

DBGET integrated database retrieval system