KEGG   Mycobacterium sp. JS623: Mycsm_06178Help
Entry
Mycsm_06178       CDS       T02423                                 

Definition
(GenBank) short-chain dehydrogenase of unknown substrate specificity
  KO
K16652  decaprenylphospho-beta-D-erythro-pentofuranosid-2-ulose 2-reductase [EC:1.1.1.333]
Organism
msa  Mycobacterium sp. JS623
Brite
KEGG Orthology (KO) [BR:msa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mycsm_06178
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.333  decaprenylphospho-beta-D-erythro-pentofuranosid-2-ulose 2-reductase
     Mycsm_06178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR
Motif
Other DBs
NCBI-ProteinID: AGB26332
UniProt: L0J6W8
Position
6125868..6126650
Genome map
AA seq 260 aa AA seqDB search
MVLDAVGNPQTILLLGGTSEIGLAICARYLRNAHARIVLADLPDHPGKDKAIAAMKEAGA
KSVDWIDFDGIDTESHPKVIDAAAAGGDIDVAIVAFGLLGDAEELWQNQRKAVQIAEINY
TAAVSVGVLVGEKMKAQGFGRIIAMSSAAGERVRRSNFVYGSTKAGLDGFYLGLGEALRE
FGVRVLVIRPGQVRTSTTIAHWKSTGTKEAPFTVDKEYVAELAVTASAKGKELVWAPGAF
RYVMMVLRHIPRPIFRKLPI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtgcttgacgccgtaggcaacccccagaccattctgctgctcggcggcacgtccgag
atcgggctggccatctgcgcgcgttatctgcgcaacgcgcatgctcgcatcgtgctggcg
gacctgcccgaccacccgggcaaggacaaggccatcgccgcgatgaaagaggccggcgcc
aagtccgtcgactggatcgacttcgacggcatcgacaccgagagccatccgaaggtcatc
gacgcggccgcagccggtggcgacatcgatgtggcgatcgtggcgttcggcctactcggc
gatgccgaagaactgtggcaaaaccagcgcaaggccgtgcagatcgccgagatcaactac
accgcggcggtttccgtcggtgtgctggtgggcgagaagatgaaggcgcagggcttcggc
cggatcatcgcgatgagctccgccgccggtgagcgggtgcgccggtccaacttcgtctac
ggatccaccaaagccggcctcgacggcttctacctcggcctcggagaagcattgcgcgag
ttcggggttcgggtgctggtgatcagacccgggcaggtgcgcaccagcacgaccatcgcg
cactggaagtccacaggcaccaaggaagcgccgttcaccgtcgacaaggagtacgtagcc
gagttggcggtcacggcatcggccaagggcaaggaactggtatgggcgccgggggcgttc
aggtacgtgatgatggtgttgcgacacattccgcggcccatcttccgcaagctccccatc
tga

DBGET integrated database retrieval system