KEGG   Mycobacterium sp. JS623: Mycsm_06179Help
Entry
Mycsm_06179       CDS       T02423                                 

Definition
(GenBank) PMT family glycosyltransferase, 4-amino-4-deoxy-L-arabinose transferase
  KO
K13686  galactan 5-O-arabinofuranosyltransferase [EC:2.4.2.46]
Organism
msa  Mycobacterium sp. JS623
Brite
KEGG Orthology (KO) [BR:msa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:msa01003]
    Mycsm_06179
Enzymes [BR:msa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.46  galactan 5-O-arabinofuranosyltransferase
     Mycsm_06179
Glycosyltransferases [BR:msa01003]
 Polysaccharide
  Bacterial polysaccharide
   Mycsm_06179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AftA_N AftA_C LptE
Motif
Other DBs
NCBI-ProteinID: AGB26333
UniProt: L0J652
Position
6126650..6128503
Genome map
AA seq 617 aa AA seqDB search
MRGALAVLGQMAVAVVVAVVVAAISLVAIARVEWPAYNSSNQLHALTTVGQFGCLAGLLA
SGWVWRRGRRLLARVGALVFLSGFAVVTLGMPLGATKLYLFGISVDQQFRTEYMTRLADT
AGPHDMTYYGLPPFYPPGWFWLGGRFAALTGTPAWEMFKPWAITSIAIAVVLTFVLWASM
IRFEYALIVSIATTAAALAYSPAEPYSAIIAVLLPAVFVLAWSGLRGATRGGGWAAVIGV
GIFLGVAALFYTLLFGYAAFTLAIMGLTLAVARRRLEPLTRLVVIAVLAGAIGLIGWGPY
LIAALNGHPADSGTAQHYLPADGAELSFPMLQFTLLGGLCMVGALWLAVRVRSSTRAGAL
AIAVLAVYAWSLLSMLTTLARTTLLSFRLQPTLTVLLAAAGTFGFVEAALAIARRYRPEV
GRRVVVAAVVLGSAGALGFTQDIPNVLKPDIVVAYTDTDADGHRADRRPPGAEQYYREID
AKIQATTGQPRNQTVVLTADYSFLSYYPYYGFQGLTSHYANPLAQFDERAKAIESWATLT
SADQFVTALDKLPWKPPTVFLMRRGANDTYTLRLAADVYPNQPNVRRYHVTLDKALFDDP
RFAVSDIGPFVLAIRKP
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggtgcgctggccgtcctcggccagatggcggtggcggtcgtcgtggcggtggtc
gttgcggcgatctcgctcgtcgcgatagcgcgtgtcgagtggcccgcctacaactcctcg
aaccagttgcacgcgctgaccactgtcggccaattcggttgcctggcaggtctgctcgca
agtgggtgggtctggcgtcgcggacgacggttgctcgcccgcgtcggtgccctggtattc
ctgtccgggttcgcggtcgtcacactggggatgccgctcggcgcgaccaagctctatctg
ttcgggatctcggtcgatcagcagttccgcacggagtacatgacccgcctcgccgacacc
gcgggcccgcacgacatgacctactacgggctgccaccgttctatccgccgggctggttc
tggctgggcgggcggttcgccgcgttgacgggcacgcccgcatgggagatgttcaagccg
tgggccatcacctctatcgcgatcgccgtggtgctgacttttgtgttgtgggccagcatg
attcgcttcgaatacgcgctgatcgtctcgatcgccaccactgcggcggcgctggcgtac
tcaccggcggagccctactcggcgatcatcgcggtgctgttgcctgccgtgttcgtgctc
gcatggtcgggtctgcgcggcgccacccgcggtggggggtgggccgcggtgatcggcgtc
gggatcttccttggagtcgcggcgctgttctacacgctgctgttcggatacgccgccttc
acgcttgcgatcatggggctgacgctcgcggtcgcccgtcgacgtctggagccattgaca
aggctcgtcgtcatcgctgtcttggccggggccatcggcctgatcggctggggcccgtac
ctgatcgccgcgctcaacggtcatcccgccgattccggcaccgcgcagcattatctgccg
gccgacggcgcagaactgtccttcccgatgctgcagttcacccttctcggcgggttgtgc
atggtcggcgcgctgtggctggcggtccgcgtccgctcgtcgacacgcgctggcgcgctg
gcgatcgcggtgctggccgtctacgcgtggtcgctgctgtcgatgctgaccacgcttgct
cgcaccacgctgctgtcgttccggttgcagccgacgctgacggtcctgctggccgcagcg
ggcacattcggatttgtcgaggccgctctcgcgatcgctcgccgctaccggccagaagtc
ggcaggcgcgtcgtcgtcgcagcggttgttctcggctcggcgggcgcactcgggttcacc
caggacattccgaacgtgctcaagcccgacatcgtcgtcgcctacaccgacaccgacgcc
gacggccaccgcgccgaccgtcggccgccaggcgccgagcagtactaccgcgagatcgac
gccaagatccaggcgacaacaggccagccgcgcaatcagaccgtcgtgctcacggcggac
tacagcttcctgtcctactacccctactacggtttccagggactgacctcgcactacgcc
aatccgctcgcgcagttcgacgagcgggccaaggcaattgaaagctgggccacgctcacc
agcgccgatcagttcgtcaccgcgctggacaagctgccctggaagccgccgacggtgttt
ctgatgcgccgcggcgccaatgacacctacacattgcgcctcgccgccgatgtctacccc
aaccagccgaacgtccgccgctatcacgtcaccctggacaaggcgctcttcgacgacccg
cggttcgcggtctccgacatcgggccgttcgtgctggcgatcaggaagccgtaa

DBGET integrated database retrieval system