KEGG   Mycobacterium sp. JS623: Mycsm_06190Help
Entry
Mycsm_06190       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF732 DUF4035
Motif
Other DBs
NCBI-ProteinID: AGB26344
UniProt: L0J4Z1
Position
complement(6158882..6159337)
Genome map
AA seq 151 aa AA seqDB search
MLHAERRATGLAKWSATSLLVASSAALLTGCSVADDVMATVGMPVSETAPAPEQPESDTN
AMVVTGQQRAYLDALNAAGVKPSSDLMALRIGSYVCQARAAKQSDQAVWDVVVPLVRGDV
RTAHLSSAVPSADEVDTATADYIRIATDKLC
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcacgcggaacgacgagcgaccggtctagcaaagtggtcggcaacatcgttgttg
gtcgcttcctcggcggccctgctgaccggatgctccgtcgccgacgacgtgatggccacc
gtcggcatgccggtgtctgagaccgcgcccgcacctgagcagccggagagcgatacgaac
gcgatggtcgtgacgggccagcagcgtgcctacctcgatgcgctcaacgccgcgggagtc
aagccgtcgagcgatctgatggcactgcgaatcgggtcgtacgtgtgccaggcccgtgcc
gccaagcagagcgatcaggcggtgtgggatgtcgtcgtgccgctggtgcgcggcgatgtg
cggaccgcacacctgagctccgcggtgccgtccgccgatgaggtcgatacggcgacggct
gactacattcggatcgcaaccgacaaactctgctag

DBGET integrated database retrieval system