KEGG   Mycobacterium sp. JS623: Mycsm_06194Help
Entry
Mycsm_06194       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
  KO
K13687  arabinofuranosyltransferase [EC:2.4.2.-]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00571  Lipoarabinomannan (LAM) biosynthesis
Brite
KEGG Orthology (KO) [BR:msa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:msa01003]
    Mycsm_06194
Enzymes [BR:msa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.-  
     Mycsm_06194
Glycosyltransferases [BR:msa01003]
 Polysaccharide
  Bacterial polysaccharide
   Mycsm_06194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGB26348
UniProt: L0J665
Position
complement(6162807..6164906)
Genome map
AA seq 699 aa AA seqDB search
MSPSSSAERKKTTGRERLARWPAFPYDVTARVSLWLSVVVVSALFGWGAWERRWIADDGL
IVLRTVRNLLAGNGPVFNAGERVESNTSTIWTYLITLGGWIGGPVRLEYVALVFALALSV
AGMALAMLGAGRLDAPGLRGRRALLLPAGALVYIAVPPARDFATSGLENGLVMAYLGLLW
WMMVCWSQALRAYPVQQQPLPRRGAPPTLRRAPYAPAPLPPPTANVVSPYFDAALAFVAG
LSVLVRPELALIGGVALIMMLVAARGWRRRVLIIVAGGLLPVGYQIFRMGYYGLLYPSTA
IAKDASGSKWAQGFVYLANFNHPYLLWAPAILLVGLGVVALATRGRPRWIRRATPPGYSW
LARRIQSPSAVVVFMLISGLLQALYWIRQGGDFMHGRVLLTPLFCLVAPVAVIPMALPDG
AKMPRGAQMPRGAAYLFASATGVLWLAVAVWSLWAANSSGMGSDATRVTYTGIVDERRFY
SQATGNPHPLTAADYLDYPRMRAVLVALNNTPDGALLLPSGNYDQWDVVPAVPPPPDMPA
DVRKDYKGPHTVFFTNLGMLGMNVGLDVRVLDQIGLANPLAAHTQRLLDGRIGHDKNLFP
DWAVADGPFLTMPPFIPAYLDEDWVMQARAALKCPATDAMLTAVRGPMGLRRFASNLLHS
PEFTSYRINRVPMYELVRCGLEIPPPKHAPYTGMPATGP
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccgtcttcctcggctgaacgaaaaaagacaactgggcgggagcgccttgcccgg
tggccggcgtttccctatgacgtaacggctcgagtcagcctctggctcagcgtcgtcgtg
gtctcagcgctattcggctggggcgcttgggagcgccgctggatagcagacgacggcctg
atcgtgctgcgtacagtgcgaaacctgttggcgggcaatggcccggtgttcaatgcgggt
gagcgtgtcgagtcaaacacgtcgacgatctggacctacctgatcaccctcggcggctgg
atcggcggcccggtacggctcgagtatgtcgcgctggtcttcgcgctggcgctcagcgtc
gccgggatggcgctggcgatgctcggcgcgggcaggctcgacgcgcccggcctgcgcggc
cgacgagcgttgttgttacccgcaggcgcactggtttacatcgcggtaccacccgcccgc
gacttcgccacctcgggtctcgaaaacggtttggtgatggcctatttgggcctgctgtgg
tggatgatggtctgctggtcgcaggcgttgcgggcctatcccgtccaacaacagccgctg
ccgcgccgcggcgctccaccgacgctgcgtagagccccgtatgcccctgcacccctgccg
ccgccgaccgccaacgtcgtcagcccttacttcgatgcggcactggctttcgtcgcgggg
ttgagcgtgctggtgcgcccggagttggcgctcatcggcggagtcgcgctgatcatgatg
ctcgtcgcggcccgtggctggcggcgccgcgtgctgatcatcgtcgcgggcgggctgctg
cccgtcggctatcagatcttccggatgggctactacggtctgctgtacccgagcaccgcc
atcgccaaagatgcgtcgggatccaaatgggcgcaaggctttgtctatctggccaacttc
aatcacccgtatctgctgtgggcgccggcgatcctgcttgtcggcctcggtgtggtcgca
ctggccacccgcggcaggccgcggtggatccgccgagccacaccgcccggctacagctgg
ttggcccgcaggatccaaagcccttccgctgttgtggttttcatgctcatcagcggactg
ttgcaggctctctactggatccggcagggcggcgacttcatgcacggccgggtgctgctg
acaccgctgttctgtctggttgcgccggtcgcggtgatcccgatggcactgcccgacggc
gccaaaatgccccggggcgcccaaatgccccgcggcgcagcctatttgttcgcaagtgcg
acgggtgtgctgtggctggcagtcgccgtttggtcgctgtgggcggccaactcatccggc
atgggctccgacgcgacgcgtgtcacttacaccggcatcgtcgacgaacgccggttctat
tcacaggccaccggcaacccgcatccgttgactgccgctgactaccttgactatccgcgc
atgcgggcagtgctcgtagcgctgaacaacacacccgacggcgcgctcctgctgccgtcg
ggcaactatgaccaatgggatgtagtgcccgcggttccgccgccgcccgacatgcccgcc
gatgtgcggaaggactacaagggcccgcacacagtgtttttcaccaatctcgggatgctc
ggcatgaacgtcgggttggacgtgcgggtgctcgaccagatcgggctggcaaacccgttg
gccgcccacacgcaacgcctactcgatggccgtatcggccacgacaagaacctcttcccg
gactgggcggtggccgatggcccgttcctgacgatgccgccgttcatcccggcctacctg
gacgaggactgggtgatgcaggccagggccgccctgaagtgtcctgcgacggacgccatg
ctcacggcagtgcgcggcccgatgggtttgcggaggtttgcgtcgaacctgctgcattca
ccggaattcaccagctaccgaattaaccgcgtgccgatgtatgagcttgtccgctgcggt
ctggagataccgccgccgaaacatgcgccgtacaccggtatgccggcaaccgggccatag

DBGET integrated database retrieval system