KEGG   Mycobacterium sp. JS623: Mycsm_06195Help
Entry
Mycsm_06195       CDS       T02423                                 

Definition
(GenBank) 4-hydroxybenzoate polyprenyltransferase-like prenyltransferase
  KO
K14136  decaprenyl-phosphate phosphoribosyltransferase [EC:2.4.2.45]
Organism
msa  Mycobacterium sp. JS623
Brite
KEGG Orthology (KO) [BR:msa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:msa01006]
    Mycsm_06195
Enzymes [BR:msa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.45  decaprenyl-phosphate phosphoribosyltransferase
     Mycsm_06195
Prenyltransferases [BR:msa01006]
 Compound prenylation
  DPPR synthase
   Mycsm_06195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiA
Motif
Other DBs
NCBI-ProteinID: AGB26349
UniProt: L0J4Z7
Position
complement(6164884..6165840)
Genome map
AA seq 318 aa AA seqDB search
MSISRESSAESAQQMSEEPAPVKGPPSNVVTGVVKALRPRQWVKNLLVLLAPVAALGSDL
HYDYGAVAVKVAIAFVAFSLAASAVYLVNDARDVEADRQHPTKRFRPIAAGVVPEWLAYT
LAVVIGVGALAISLLATPNLAVVIAIYIAIQLAYCFGLKHQAVLDICIVSSGFLIRAIAG
GVAASIPLSQWFLLVMTFGSLFMAAGKRYAELQLAERTGAKIRKSLESYTASYLRFVWTL
SATAMVLCYSLWAFERDGANASWYAVTIIPITIAVLRYAVDVDGGLAGEPEEIASKDRVL
QLLLLAWIGTIGVAVFLG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcatctcgagggaaagcagtgcagagagcgcccagcagatgagtgaagaaccggca
ccggtcaagggtccgcccagcaatgtcgtcacgggtgtggtcaaggcgctccgtccgcga
cagtgggtgaagaaccttctggtgctgctagcgccggtggccgccctgggctctgacctt
cactacgactacggcgccgttgcggtcaaggtcgcgattgccttcgtcgccttttcgctg
gcggcctcggcggtctatctggtgaacgacgcgcgcgacgtcgaggccgatcgtcagcac
cccaccaaacgcttccgtccgatcgcggccggtgtggtgccggagtggctcgcatacacc
cttgcggtggttattggggttggcgcgcttgcgatttcactgctcgcaacgccgaatctg
gccgtggtgatcgccatctatatcgctattcaactggcctactgcttcggtctcaaacat
caggccgtcctcgacatctgcatcgtttcgtcaggctttctgatccgcgcgatcgccggc
ggcgtggccgccagtattccgctgtcgcaatggttcctgctggtgatgacatttgggtcg
ctgttcatggcggcgggcaaacgctacgccgaactgcaactcgccgagcggacgggcgcc
aagatccgcaagtcgctcgagagctacaccgcttcgtacctacgttttgtgtggaccctg
tcggccactgcgatggtgctgtgttacagcttgtgggcattcgagcgcgacggtgcaaac
gcgtcgtggtacgcggtgaccatcattccgatcacgatcgcagtcctccggtacgccgtt
gacgtcgacggtgggttggcaggtgagccggaggagatcgcgtcgaaggaccgtgtgctg
cagctcctgctcctggcctggatcggaaccatcggtgtcgccgtcttcctcggctga

DBGET integrated database retrieval system