KEGG   Mycobacterium sp. JS623: Mycsm_06198Help
Entry
Mycsm_06198       CDS       T02423                                 

Definition
(GenBank) UDP-galactopyranose mutase
  KO
K01854  UDP-galactopyranose mutase [EC:5.4.99.9]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00052  Galactose metabolism
msa00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Mycsm_06198
   00520 Amino sugar and nucleotide sugar metabolism
    Mycsm_06198
Enzymes [BR:msa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.9  UDP-galactopyranose mutase
     Mycsm_06198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GLF NAD_binding_8 Amino_oxidase FAD_oxidored NAD_binding_9 Thi4 DAO Pyr_redox Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AGB26352
UniProt: L0J6Y5
Position
complement(6168315..6169514)
Genome map
AA seq 399 aa AA seqDB search
MTAHFDLFVVGSGFFGLTIAERVATQLDKRVLVVERRQHIGGNAYSEPEPQTGIEVHKYG
AHLFHTSNQRVWDYVRQFTDFTGYQHRVFAMHNGQAYQFPMGLGLVSQFFGKYFTPDEAR
QLIKEQAAEIQTADAQNLEEKAISLIGRPLYEAFVKGYTAKQWQTDPKELPAANIARLPV
RYTFDNRYFSDTYEGLPAEGYTVWLKNMAADERIEVRLDTDWFDVRNQLRAESPDAPVIY
TGPLDRYFDYAEGRLGWRTLDFEVEVLDTGDFQGTPVMNYNDADVPYTRIHEFRHFHPER
AYPTDKTVIMREYSRFADDDDEPYYPINTEADRAVLGAYRARAKAETASSKVLFGGRLGT
YQYLDMHMAIASALNMYDNVLAPHLRDGAPLHDDESNSA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcattttgatctgttcgtcgtcggttccgggttcttcggtctgacgattgcc
gagcgcgtggcgacgcaactggacaagcgtgtgctagtcgtggagcgccgccagcacatc
ggcggtaatgcgtactccgaacccgagccgcagaccggtatcgaggtgcacaagtacggc
gcacacctgttccacacctccaatcaacgggtgtgggactacgtgcgccagttcaccgac
ttcaccggatatcagcaccgggtgttcgcgatgcacaacgggcaggcctaccagttcccg
atggggcttggcctggtgtcgcaattcttcggcaagtacttcaccccggatgaagcgcgc
cagctgatcaaggagcaggccgcggagatccagaccgcagacgctcagaacctggaagaa
aaggccatctcgttgatcggccgcccgctgtacgaggcgttcgtcaagggctacaccgcc
aagcagtggcagaccgaccccaaggaactgcccgcggccaacatcgcccggttgcctgtg
cgctacaccttcgacaaccgctacttcagcgacacctacgagggtctgcccgccgagggc
tacaccgtatggctgaagaacatggccgccgacgagcgcatcgaggtgcggctggacacc
gactggttcgatgtccgcaaccagctgcgcgcggaaagccccgacgcgcccgtcatctac
accgggccattggatcgctacttcgactacgccgagggccggttgggttggcgcacactc
gatttcgaggtcgaggtactcgacaccggggacttccagggcaccccggtgatgaattac
aacgacgccgacgtgccctacacgcggatccacgagttccgccacttccaccccgagcgg
gcctacccgacagacaagacggtgatcatgcgggagtactcccgcttcgccgatgacgac
gacgagccctattacccgatcaacaccgaagccgaccgggccgtgctcggcgcgtaccgt
gcgcgtgccaaggccgagacggcatcatcgaaggtgttgttcggcggccgactgggcacc
taccagtacctcgatatgcacatggccatcgccagtgcgctgaatatgtacgacaacgta
ctggcgccgcacctgcgtgacggcgcgcccctacacgacgatgaaagcaacagcgcatga

DBGET integrated database retrieval system