KEGG   Mycobacterium sp. JS623: Mycsm_06201Help
Entry
Mycsm_06201       CDS       T02423                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IIB
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 S6PP Hydrolase HAD
Motif
Other DBs
NCBI-ProteinID: AGB26355
UniProt: L0J488
Position
complement(6172090..6172902)
Genome map
AA seq 270 aa AA seqDB search
MTPDLIASDVDGTLLDDDEKVTARTREAVSAAVGAGATFVLATGRPPRWVQPVVDALGFA
PMAVCANGAVIYDPSADRIVSARTLSADVLGELAEVATRVIPGAGLAVERVGTSAHDAAT
PQFVSSPGYEHAWLNPDNTEVSIEDLLSAPAVKLLIRKAGARSSDMAEALAKHVGLEGDL
TYSTNNGLIEVVPLGISKATGVEELARPLGISAEGVVAFGDMPNDVPMLSWAGLGVAMGN
AHPDAVAAANEVTAPNTEDGVARVLERWWH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgactcctgacctgattgcctccgatgtggacggcacgctgctcgacgacgacgagaag
gtcacggcccgcacccgagaggccgtatcggcggccgtgggtgccggcgcgacgttcgtg
cttgccaccggccgccctccgcgatgggtgcagccggtcgttgacgcgctggggttcgcg
ccaatggcagtgtgtgccaacggcgcagtgatctacgacccctcggcggaccgaatcgtt
tcggcccgaacgctttccgccgatgtacttggcgagctggccgaggtcgccactcgtgtc
atccccggcgcgggcctggccgtcgagcgcgtcggcaccagtgcccacgacgcggccacc
ccgcaattcgtcagctcacctggctacgagcatgcctggctgaacccggacaacaccgag
gtgtccatcgaggatctgctcagcgcgcccgcggtcaagctgctgatccgcaaggccggt
gcccgcagctcggatatggctgaggcgctggccaaacatgttgggctggaaggtgatttg
acgtactccaccaacaacggcctgattgaggtcgtgccactcggcatcagcaaggccacc
ggcgtcgaggagcttgcgcgcccgcttggcatcagcgccgagggcgtggtcgcgttcggt
gacatgcccaatgacgtgccgatgctgtcgtgggccggcctcggcgtggcgatgggcaat
gctcatcctgatgcggtggccgcggccaacgaggtcaccgcgcccaacaccgaagatggt
gtcgcgcgcgttctcgaacgctggtggcactga

DBGET integrated database retrieval system