KEGG   Mycobacterium sp. JS623: Mycsm_06202Help
Entry
Mycsm_06202       CDS       T02423                                 

Definition
(GenBank) 1-acyl-sn-glycerol-3-phosphate acyltransferase
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-ProteinID: AGB26356
UniProt: L0J7S1
Position
complement(6172899..6173663)
Genome map
AA seq 254 aa AA seqDB search
MEPVFRALEIAVSTATKVTGTKITYQGLENIPERGGAVMAINHTSYLDWAPAALAAYQRH
RRMRFMIKAEMQDVKVVNFLIKHSGTIPVDRGAGAGAYSVAVERLRAGEIVGVYPEATIS
RSFELKEFKTGAARMARDADVPIVPLIVWGAHRRWTKDHRKDLKRKSKIPVTVAVGAPVV
AADTLDQTSAAMREAMTALLHKVQLDYPHPEGAYWVPRRMGGTAPTLEEAKALDEAELAE
RARKRAERAAKSHR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggttttccgtgcgctcgagattgccgtcagcacagcgacgaaagtcaccggg
acaaagatcacctaccagggtctggaaaacatcccggaacgcggcggcgccgtcatggcg
atcaaccacacgagctacctcgactgggctccggcagcgctggccgcgtatcagcggcac
cgccggatgcggttcatgatcaaggctgagatgcaggacgtgaaggtcgtcaacttcctg
atcaagcactccggcaccatcccggtggaccgcggcgcgggcgcaggcgcgtactcggtt
gcggttgagcgacttcgggcaggcgagatcgtcggggtgtatccggaagccaccatcagc
cgcagcttcgaattgaaggagttcaagacgggcgcggcgagaatggcccgcgacgccgac
gtgccgatcgttccgctgatcgtgtggggcgcgcaccgacggtggaccaaggatcaccga
aaagacttgaagcgcaagagcaaaatcccggtgaccgtcgcagttggtgcgcccgtggtt
gccgccgacaccctcgaccagacgagtgcagcgatgcgtgaggcgatgacggcgctgctg
cacaaggtgcagctggactatccgcatcccgagggtgcgtattgggtgccccgccggatg
ggcggcaccgcaccgacgctcgaagaggccaaggcgcttgacgaggcggagttggccgag
cgcgcgcgcaagcgggccgagcgtgcggcgaagagccaccggtga

DBGET integrated database retrieval system