KEGG   Mycobacterium sp. JS623: Mycsm_06207Help
Entry
Mycsm_06207       CDS       T02423                                 

Definition
(GenBank) seryl-tRNA synthetase
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00970  Aminoacyl-tRNA biosynthesis
Module
msa_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:msa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mycsm_06207
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:msa01007]
    Mycsm_06207
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:msa03016]
    Mycsm_06207
Enzymes [BR:msa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     Mycsm_06207
Amino acid related enzymes [BR:msa01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   Mycsm_06207
Transfer RNA biogenesis [BR:msa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Mycsm_06207
 Prokaryotic Type
    Mycsm_06207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N
Motif
Other DBs
NCBI-ProteinID: AGB26361
UniProt: L0J7S4
Position
complement(6177165..6178424)
Genome map
AA seq 419 aa AA seqDB search
MIDLKLLRENPDLVRASQRARGEDPTLVDALREADSARRSAVSTADNMRAEQKSLSKRVG
KASPDERPALLEQAKTFAEKVKVAEAEQAAAENAFTAAHMAIPNVIINGVPAGGEDDFAV
LDTVGKPPAIEAPKDHLELGESLGLIDMERGAKVSGSRFYFLTGAGALLQLGLLQLAVRL
ATANGFTLVIPPVLVRPEVMAGTGFLGAHADEVYRVEADDLYLVGTSEVPLAGYHANEIL
DLSDGPLRYAGWSSCFRREAGSYGKDTRGIIRVHQFDKVEGFVYCKPEDAEAEHDRLLGW
QRQMLAQIEVPYRVIDVAAGDLGSSAARKFDCEAWVPTQGTYRELTSTSNCTTFQARRLS
VRYRDENGKPQTAATLNGTLGTTRWLVAILENHQQPDGSVRIPEALVPYVGAEVLEPKG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgacctcaagctgctacgcgaaaatccggatctggtgcgcgcgtctcagcgggcc
cgtggcgaagacccgacgctcgtcgatgcgctgcgcgaagccgactccgctcgccgctcg
gcggtgtcgaccgccgacaacatgcgcgccgagcagaagtccctcagcaagcgggtgggc
aaggcgtcgccggacgagcggccggcgctgctggagcaggccaagactttcgccgagaag
gtcaaggtagccgaggccgagcaggctgcggccgaaaacgctttcaccgcagcgcatatg
gcgatcccgaacgtgatcatcaacggtgtaccggctggcggtgaggacgacttcgcggtg
ctcgacaccgtcgggaaaccaccggccatcgaagccccgaaggaccacctcgaactcggc
gagtccctcggcctgatcgacatggagcgcggcgcgaaggtgtcgggctcgcggttctac
tttctgaccggtgcgggtgccttgttgcagcttggcctgttgcagctcgcggtccgactg
gcgacggccaacggcttcacgctcgtcatcccaccggtgctggtgcgtcccgaggtgatg
gcgggtaccggcttcctgggagcgcacgccgacgaggtgtaccgcgtcgaagccgacgac
ctctatctggtcggcacgtccgaggtgccactggccggctatcacgccaacgagattctc
gacctgtccgacggcccgctgcgctacgccggctggtcgtcgtgctttcgccgtgaggcg
ggcagctacggcaaggacacccggggcatcatccgcgtgcaccagttcgacaaggtcgag
ggcttcgtctactgcaaaccggaggatgccgaggccgaacacgaccggctgctcggctgg
cagcggcagatgctcgcgcagatcgaggtgccatatcgtgtgatcgacgttgccgcaggc
gatttgggttcttcggcggcacgcaaattcgattgtgaggcctgggttccgacgcagggc
acctaccgcgagctgacttcgacgtcgaactgcaccaccttccaggcgcgacggctgtca
gtgcgctaccgcgacgagaacggcaagccgcagaccgccgcgacgctcaacggaaccctc
ggcaccacgcgatggttggtggcgatcctggagaatcatcaacagcccgacggcagcgtc
cgcatccccgaggcgctggtgccgtatgtcggcgccgaggtactcgagccgaagggctag

DBGET integrated database retrieval system