KEGG   Mycobacterium sp. JS623: Mycsm_06215Help
Entry
Mycsm_06215       CDS       T02423                                 

Definition
(GenBank) cell envelope-related transcriptional attenuator
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LytR_cpsA_psr
Motif
Other DBs
NCBI-ProteinID: AGB26369
UniProt: L0J513
Position
6184118..6185059
Genome map
AA seq 313 aa AA seqDB search
MLFAFLLVFVVAVVAGGWWMDTSLHRIPALADYPERPATGKGTTWLLVGSDSRQGLTPEQ
QAELTTGDDLGNGRTDTILLVHVPAFGSSAPTTMVSIPRDSYVPIPGYGEDKINAAFSEG
GAPLLAQTVEQATGIRLDHYAEIGFAGFAVLVDAVGGVTMCPAEPINDPLAGIDLPAGCQ
KLNGRNALGFVRTRATPRADLDRMVNQRQFMEALMHRAASPAVLLNPLRWYPMAHAVNGA
LTVDQGAHIWDLARLAWSLHGDITTTTVPIGEFTGSDSGSVVVWNSDAAGRLFAALTSDS
PVPQDVLDAAKPG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgctgttcgcattcctgttggtattcgtcgtcgcggtggtggctggcggatggtggatg
gacacctcgctgcatcgcatccccgcactcgccgactaccctgagcggcctgccaccggc
aagggcacgacctggctgctggtcggctcggacagccgccagggcctgacccccgaacag
caggccgagctgaccaccggcgacgacttgggcaacggccgcaccgacaccatcctgctc
gtgcatgtgccggccttcgggtcaagcgcgccgaccacgatggtgtcgatccctcgcgat
tcctacgtgccgattcccggctacggcgaggacaagatcaacgccgcgttctccgagggt
ggggccccgctgttggcgcagaccgtcgagcaggccacgggaatccgactcgatcactac
gccgagatcggattcgccggtttcgccgtcctcgtcgacgcggtcggcggcgtgaccatg
tgcccggccgaaccgatcaacgacccgctcgcaggcatcgacctgccggcgggttgtcag
aagctcaacggccgcaatgcgctcggctttgtccgcacccgcgccaccccgcgggccgac
ctggatcggatggtcaaccagcgacagttcatggaggcgttgatgcatcgcgccgccagc
cctgcggtgctgctcaatccgctgcgctggtatcccatggcgcacgcggtcaacggcgca
ctcaccgtcgatcaaggtgcccacatctgggatctggcccgactggcatggtcgttgcac
ggggacatcaccaccacgaccgtgccgatcggcgagttcaccggcagcgactccggctcc
gtcgtggtctggaacagcgacgccgcgggccgcttgttcgccgcgttgacgtcggattcg
cctgtcccgcaggacgttctggacgccgccaaacctggctag

DBGET integrated database retrieval system