KEGG   Mycobacterium sp. JS623: Mycsm_06217Help
Entry
Mycsm_06217       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4328 HypA OrfB_Zn_ribbon DUF2721 zinc_ribbon_4 DZR Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: AGB26371
UniProt: L0J7T4
Position
complement(6185885..6186913)
Genome map
AA seq 342 aa AA seqDB search
MIQVCSQCGTRWNVRDRRRVWCPRCNGTLHAPSGPPPGTEWRPTASPLGQGNRPPGRPLP
PGYRWIAVRPGAAPPPRRRSRALGPTPRYGAIPRWGLVDHFETSDVQTAAAPRTGPSLAM
VRGALVATIVMLGVAAFVHVVRYVLLIVNRSILLNKIVAFAATWAGVLVSVIALFMVVAS
LVVLTNWLIARRAAAYAHHRRDDPRSAAALRLGCLVPLVNLFWAPVFVLELAGVEERLNW
LRRPIATWWIVWAFSYVLSIFSIATSFTQDAQGIADNTVTTIVAYLLTMAALLLAMKVFL
GFERQPVERSTRRWVIVRDDQKAEKAQAPAVAVESEGQDPAA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgatccaggtgtgttcccagtgcggaacgcggtggaacgtgcgcgatcgaaggcgggtc
tggtgcccgcggtgcaacgggacgctgcacgcgccgtcggggccgccgcctggtaccgaa
tggcggccgacagcttctccgctcgggcagggcaaccggccgcctggccggccactgccg
cccggataccgctggatcgcggtgcgcccaggcgcggcgccgccgccgcgacgccgctcg
cgggctctcggcccaactcctcgctacggggccattccgcgatggggtctggtcgaccac
ttcgagacgtctgacgtgcagacggccgccgctccgcgaaccggaccatcgctggcaatg
gtgcgtggcgcgctggtcgcgaccatcgtgatgctcggcgtggccgcgttcgtacacgtg
gtgcggtatgtgctgctcatcgtcaaccgatcgattttgttgaacaagatcgtggcgttc
gccgccacctgggccggcgtgctcgtcagcgtcattgcactgttcatggtcgtggccagc
ctggtggtgctgaccaattggcttatcgcgcggcgggccgccgcctacgcgcatcaccgc
cgcgacgatccccgctccgcggcggccctgcgcctgggttgccttgtgccgcttgtgaat
ctgttctgggcgccggtgttcgtgctcgagttggcgggcgtcgaagagcggttgaactgg
ctgcgcagaccgatcgcgacgtggtggatcgtctgggccttcagctacgtgttgtcgatc
ttctcgatcgcgaccagcttcacgcaggatgcgcagggcatcgcagacaacacggtgacc
acgatcgtcgcctacctgctgaccatggcggcgctgctgttggccatgaaggtgttcctc
ggcttcgaacgccagcccgtggaacgctcgaccaggcgctgggtgatcgtccgcgacgac
caaaaagccgaaaaagcccaagccccggccgttgcggttgagtctgaaggccaggacccg
gcagcatag

DBGET integrated database retrieval system