KEGG   Mycobacterium sp. JS623: Mycsm_06222Help
Entry
Mycsm_06222       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGB26376
UniProt: L0J7T5
Position
6188961..6189494
Genome map
AA seq 177 aa AA seqDB search
MENGSDRAIEIAPFHSRGSLKGFVVSGRWPDSTKEWAQLLIVAVRIASLPGLLSTTTIFG
AREELPDAPVPGTVGLVVAEGTVVGETAVPPGHFAEHQPPALLMLHPPSETMPSLPECTG
AASGCVLLPGLPYLGLEHRAAWVEAEADGTVTSMVSRVGVDPISHPDTAILAMLLAA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggagaacggatctgaccgggcgatcgagatcgccccattccattcgcgcgggtcgctc
aaagggttcgtggtatccggccggtggccggactcgaccaaggaatgggcacagctactg
atagtcgcggtgcgcatcgcgtcactgcccggattgctgtccaccacaacgattttcggt
gcgcgcgaggagcttcccgacgcgccggtgcccggaaccgttgggctggtggtggccgaa
ggcacagtggtcggtgaaacagccgtgcccccagggcatttcgcggagcatcagccgccc
gcactgctcatgctgcacccgccatcggaaaccatgccgtcgctgccggagtgcaccggc
gcggcatcgggttgcgtactgctgccggggcttccgtatctgggtctcgagcatcgcgcc
gcgtgggtcgaagcagaagccgacggcaccgtgacgtcgatggtgagccgcgtcggcgtc
gatcccatcagccatcccgacaccgctatcttggcgatgctgcttgcggcataa

DBGET integrated database retrieval system