KEGG   Mycobacterium sp. JS623: Mycsm_06225Help
Entry
Mycsm_06225       CDS       T02423                                 

Definition
(GenBank) Helix-turn-helix protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_31
Motif
Other DBs
NCBI-ProteinID: AGB26378
UniProt: L0J682
Position
6190896..6191294
Genome map
AA seq 132 aa AA seqDB search
MSKTFAARLNRLFDTVYPPGRGPHTSAEVIAALKAEGVTMSAPYLSQLRSGNRTNPSAAT
MAALANFFRIKPAYFTDDEYYEKLDKELTWLANMRDEGVRRIAARTVGLSAEAQQDIVSK
VDELRRREHLDD
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacgttcgccgcccggctaaaccgcctgttcgacacggtttacccgcccggt
cgtggcccgcatacgtccgccgaagtcatcgccgcgctcaaggcagaaggcgtcacgatg
tctgctccgtacctgtcgcagctccgctcaggcaaccgcaccaacccctcggcagccacc
atggcagcccttgccaacttcttccggatcaagccggcctacttcaccgacgacgagtac
tacgagaagcttgacaaggaattgacctggctggcgaatatgcgcgacgagggtgttcgc
cgtattgcggcgcgcacggttggcctgtccgcagaagcccagcaggacattgtttctaag
gtcgacgagctgcgtcgccgggagcacctggacgattag

DBGET integrated database retrieval system