KEGG   Mycobacterium sp. JS623: Mycsm_06228Help
Entry
Mycsm_06228       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AGB26381
UniProt: L0J7U0
Position
6193374..6194225
Genome map
AA seq 283 aa AA seqDB search
MTGRVIGGIGSSTAAAPTPGTTSIADGSDAGGSCMSGTAGRPDGTSTAPPLPPPPPPGPG
TPTEEVAGVEVSLDVVVVLLLDVVSLDVVSLDVVSLDVVRLVVVRDVVVFVDDSVVELVV
DGPGGLVSVLPPRQPCAFPLLPSLPQLPLPGLSPLPGLSSAVCGSFSVLVFEPPLPTESF
FGLLPWTSCECVPDGDSDDAEGSAIASAPPRPYRYRPTATKQADAALCTREPTWSPPFKA
SAAAHSQDPSFLHSQGKRFAVELNVPARRTRRNRRLPGTIMLG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcagggtgatcggcgggatcgggagctcaacggccgctgctccgacgcctgga
acgacgtcgatcgcggatggttcggacgctggcggcagttgcatgtccggtactgccggg
cgcccggacggcacgtcgacggcgccgccgctcccaccgccacctccaccgggtccgggc
acgcccaccgaagaggtcgcgggggtggaggtctcgctggatgtcgtggtggtcttgctg
ctggacgttgtctcactggacgtcgtctcgctggacgtcgtctcactggacgttgttcga
ctggtagtcgttcgcgacgtcgtcgtctttgtcgacgattccgtcgtggagttggtcgtc
gacggacccggcggactcgtctcggtgcttccgccgcggcagccgtgcgcgttcccgttg
cttccgtcgttgccgcagttgccgttgcccggattgtcgccgttgccaggtttgtcgtcg
gcggtctgcggctccttttcggttttggttttcgagccgccgctgccaacggaatcgttc
ttcggcctgttgccatggacgtcgtgtgaatgcgtaccggacggcgactctgatgacgct
gagggctcggcgattgccagcgcgccgccgaggccatacaggtataggccaacagccacg
aagcaggccgacgcggcgctgtgcacccgcgaacccacgtggtcaccacccttcaaggcg
tcggcagccgcccattcacaagacccgtcattcttgcacagccagggcaaacggttcgct
gtggagttgaacgtacccgcgaggaggacacgtcgaaaccgacggttacccgggacgata
atgttgggctga

DBGET integrated database retrieval system