KEGG   Mycobacterium sp. JS623: Mycsm_06236Help
Entry
Mycsm_06236       CDS       T02423                                 

Definition
(GenBank) RraA family protein
  KO
K02553  regulator of ribonuclease activity A
Organism
msa  Mycobacterium sp. JS623
Brite
KEGG Orthology (KO) [BR:msa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:msa03019]
    Mycsm_06236
Messenger RNA biogenesis [BR:msa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     Mycsm_06236
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RraA-like
Motif
Other DBs
NCBI-ProteinID: AGB26389
UniProt: L0J532
Position
6198895..6199377
Genome map
AA seq 160 aa AA seqDB search
MTIEPRPTADLVDEIGPDVRSCDLQFKQYGGRVQFAGSITTVRCFQDNALLKSVLSEPGN
GGVLVIDGDGSLHSALVGDLIAGLGVDNGWVGLIINGAVRDAATLRTLEIGIKALGTNPR
KSSKTGDGQRDVAVEFGGVVFKPGEIAYSDDDGIVVVAKD
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgagccccgccccaccgctgacctcgtcgacgaaatcggaccggacgtccgc
agctgcgacctgcagttcaaacagtacggcggtcgtgtgcagttcgcggggtcgatcacg
acagtccggtgctttcaggacaacgcgctgctgaaatctgtgctgtccgagccgggtaac
ggcggggtgctggtgatcgacggtgacggctcgctccacagcgcactcgtcggcgacctg
atcgccggtctcggcgtcgacaacggctgggtcgggctgatcatcaacggggcggttcgc
gatgcggctaccctgcgcacactcgagatcggcatcaaggcgcttggcactaatccgcgc
aagagcagcaagaccggcgatggtcagcgggatgtcgccgtcgagttcggtggcgtggtt
ttcaagcccggtgagatcgcctatagcgacgacgacggcattgtcgtcgtcgccaaggac
tag

DBGET integrated database retrieval system