KEGG   Mycobacterium sp. JS623: Mycsm_06238Help
Entry
Mycsm_06238       CDS       T02423                                 

Definition
(GenBank) transcriptional regulator
  KO
K21961  TetR/AcrR family transcriptional regulator, ethionamide resistance regulator
Organism
msa  Mycobacterium sp. JS623
Brite
KEGG Orthology (KO) [BR:msa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:msa03000]
    Mycsm_06238
Transcription factors [BR:msa03000]
 Prokaryotic Type
  Helix-turn-helix
   TetR/AcrR family
    Mycsm_06238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N HTH_10
Motif
Other DBs
NCBI-ProteinID: AGB26391
UniProt: L0J7U9
Position
6200946..6201587
Genome map
AA seq 213 aa AA seqDB search
MTTVSQPRAARGRRATRPSGDDRELAIFATLERLLQGRSFAEISVDDLAKGAGISRPTFY
FYFPSKDAVLLTLFERVLAEADATFEGSPEDYAADPARAWRDGIYAFFEPLRAHLPVALA
GVAATGANAEIRELWSTFMQKWVDRTAAVITAERVRGAAPESVPAQDLAAALNLMNERTM
FASYTGQKPSIVEDAALDTLVYVWITSIYGRTP
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaccgtcagccagcctcgtgcagcccgtgggcgccgcgcgacacggccgtccggc
gacgaccgcgagctggctattttcgccacgctcgagcggttgctgcagggccgatcgttc
gccgagatctccgtggatgacctggctaaaggcgccggaatctcgcgcccgacgttctac
ttttacttcccgtcgaaagacgcggtgctgctgacgctgttcgagcgggtgctcgcggag
gccgatgcgacgttcgagggtagccccgaggactacgccgccgaccccgcgcgggcctgg
cgcgacggcatctacgcattcttcgaaccgctgcgcgcgcacctgccggtcgcgctcgcg
ggtgtggctgcgaccggggccaacgccgagatccgtgaactgtggtcgacgttcatgcag
aagtgggtggaccggaccgcggccgtcatcaccgccgaacgtgttcgtggcgccgcaccg
gagagcgtgcctgcacaagatctcgctgcagcgctgaacctgatgaacgagcggacgatg
ttcgcctcctataccggccagaaaccgtccatcgtggaagacgctgcgctcgacacgctg
gtgtacgtctggatcaccagcatttacggccgcactccataa

DBGET integrated database retrieval system