KEGG   Mycobacterium sp. JS623: Mycsm_06241Help
Entry
Mycsm_06241       CDS       T02423                                 

Definition
(GenBank) TIGR03086 family protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MDMPI_N DinB_2 DUF664
Motif
Other DBs
NCBI-ProteinID: AGB26394
UniProt: L0J536
Position
complement(6203864..6204427)
Genome map
AA seq 187 aa AA seqDB search
MNFAPACERTANALRNVTDDQLDDRTPCEKLSLRDLVGHVGGLALAFTAAARKDFGPLTD
TPPVEGAPLDEDWRTAYPQRLAELAAAWREPAAWEGMTRAGGVDFPAEVGGIVALTEVVI
HGWDVAAATGQDYDVDPATLEAVLPHVTATAEQGPVEGLFGPAVPVSDDAPMLDRVIALS
GRDPAGR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgctcctgcctgtgaacgcaccgcgaacgcgctgaggaacgtgaccgacgat
cagctcgacgaccggacgccgtgcgaaaagctgagcctgcgagaccttgtcggtcatgtg
ggcgggctggcgttagcgttcaccgcggccgcgcgcaaggacttcggcccgctgacggac
accccgcccgtggagggcgcgcccctggatgaggactggcgtaccgcctacccgcagcgg
ctggcggaattggcggcggcgtggcgtgagccggcggcgtgggagggcatgacgcgcgcc
ggtggcgtcgactttcccgccgaggtcggcggcatcgtcgcgctcaccgaggtggtgatc
cacggctgggacgtggcggctgcgacgggccaggactacgacgtcgaccccgccaccctg
gaggcggtgctaccgcacgtgacggcgactgccgagcaggggccggtcgagggattgttc
ggaccggcggtgccggtttccgatgacgcgccgatgcttgatcgggtcattgcgctgagc
ggacgcgacccggcgggccgctag

DBGET integrated database retrieval system