KEGG   Mycobacterium sp. JS623: Mycsm_06242Help
Entry
Mycsm_06242       CDS       T02423                                 

Definition
(GenBank) putative F420-dependent oxidoreductase, Rv1855c family
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_luciferase
Motif
Other DBs
NCBI-ProteinID: AGB26395
UniProt: L0J4C5
Position
6204492..6205379
Genome map
AA seq 295 aa AA seqDB search
MRFAFKTSPQNTTWSDMLAVWQAADDIDVFESGWTFDHFYPIFSDSSGPCLEGWTTLTAL
AQATNRLRVGVLVTGIHYRHPAVLANMASALDIVSNGRLELGIGAGWNEEESGAYGIELG
SIKERFDRFEEACQVLTSLLSKDSTTFDGKFYQLKDARNEPKGPQKPHPPICIGGSGEKR
TLRITAKYAQHWNFVGGPPAEFARKRDVLAAHCADIGRDPKEIMLSSHVRLSDNHLEHGK
PLDHGHALAEAAALGEEGLDLAIIYLPTPHTPAVLEPLAEAIRDSGLLTSKDNGR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgagattcgcattcaagacttccccgcagaacaccacgtggtcggacatgctcgccgtt
tggcaggccgccgacgacatcgacgttttcgagtccggctggactttcgaccacttctat
ccgattttctccgactcctcagggccctgcctggagggctggacgaccctgacggcgctc
gcgcaggccaccaatcgccttcgcgtcggcgtgctggtgactggcattcactatcgccac
cccgccgtgctcgccaacatggcgtcggctctcgacatcgtttcgaacggccggctcgag
ctcggcatcggcgcgggctggaacgaagaggagtccggcgcctacggcatcgagctcggc
agcatcaaggaacgcttcgatcggttcgaggaagcctgtcaggtgcttaccagcctgctg
agtaaggacagcacgacgttcgacggcaagttctatcagctcaaggacgcgcgcaacgag
ccgaagggaccgcagaagccgcacccgccgatctgcattggcggcagcggcgagaagcgg
acgctgcgcatcaccgccaagtatgcgcagcactggaacttcgtcggcgggccaccggcg
gagttcgcccgaaagcgcgacgtcctcgccgcacactgcgcggacatcggcagggatccg
aaggagatcatgctctcctcgcacgtgcggttgagcgacaaccacctcgagcacggcaag
ccgctggaccacgggcacgcgctcgccgaggcggccgcgctcggggaagaggggctggat
ctggcgatcatctatctgccgacgccgcatacccccgccgtacttgaaccgctcgccgag
gcgatcagggattccgggctgctcaccagcaaagacaatggacggtaa

DBGET integrated database retrieval system