KEGG   Mycobacterium sp. JS623: Mycsm_06249Help
Entry
Mycsm_06249       CDS       T02423                                 

Definition
(GenBank) hypothetical protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT 4HBT_3
Motif
Other DBs
NCBI-ProteinID: AGB26402
UniProt: L0J720
Position
6215361..6215864
Genome map
AA seq 167 aa AA seqDB search
MSHPLSTPLGRFGIVTAEEGPQRCVASIPAGAMANPLTGQPTVAAVAMLVDHVGGLINHH
RRGGATKVLVADSDPVLNNSLGIVHGGVSAMALELVGSAAVNDGRGDQPLLTASLRVNFL
RQFYSGPESRYEATALQVGRSSGVAEALAVDASGKPAIIARITAYLG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatccgctgagcacgccactgggccggttcggcatcgtgacggccgaggaaggc
ccgcagcgctgcgttgcctccatccccgcgggcgcgatggccaacccgctcaccggtcaa
ccgaccgtcgcggcggtggcgatgctcgtcgaccacgtcggcggtttgatcaaccatcac
cgcaggggaggcgcgacgaaagtcctggtggccgactccgatccggtgctgaacaacagc
ctgggcatcgtgcacggcggggtgtcggcgatggcgctggagctggtcggctcggccgct
gtcaacgacggccgcggggaccagcctctgctcacggcctcgctgcgcgtgaattttctg
cgtcagttttacagtggacccgaatcccgttatgaggcaacagctttgcaggtcggacgc
agcagcggcgtcgcggaggccctggccgttgacgcctccggtaagccggcgatcatcgcc
cgcatcacggcctacctcggatag

DBGET integrated database retrieval system