KEGG   Mycobacterium sp. JS623: Mycsm_06255Help
Entry
Mycsm_06255       CDS       T02423                                 

Definition
(GenBank) Polyketide cyclase / dehydrase and lipid transport
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc AHSA1
Motif
Other DBs
NCBI-ProteinID: AGB26408
UniProt: L0J6A8
Position
6220465..6220935
Genome map
AA seq 156 aa AA seqDB search
MTDPGAACAQAEVSINADPERVYHLITDLSTLAACAEEAAAMKWLKGDSARPGAVFKGTN
RNGMRQWSTKCTVTDAEPGRAFAFDVGYFGIPVAHWRYDIAAEGDGCRLTERMWDRRPGW
FVKPGGLATGVMDRSSANAEHIKLTLQRLKEKAEAG
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgactgatccgggcgccgcatgcgcgcaggccgaggtgagcatcaatgccgaccccgag
cgggtgtaccacctgatcaccgacctctcgacgcttgccgcatgcgccgaggaggccgca
gcgatgaaatggctgaagggcgactccgcgcggcctggcgcggtgttcaagggaacgaac
cgcaacggaatgcggcagtggagcaccaagtgcaccgtcaccgacgccgaacccggtcga
gcgttcgcctttgacgtcggctatttcgggatccccgtcgcgcactggcgctacgacata
gctgccgaaggcgacggctgccgactgaccgaacggatgtgggaccgccgacccggctgg
ttcgtgaagcccggcggcctggccaccggggtgatggaccgctcttcggccaacgccgag
cacatcaagttgacgctgcaacgcctgaaggaaaaggccgaagcgggctag

DBGET integrated database retrieval system