KEGG   Mycobacterium sp. JS623: Mycsm_06264Help
Entry
Mycsm_06264       CDS       T02423                                 

Definition
(GenBank) methionine-R-sulfoxide reductase
  KO
K07305  peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12]
Organism
msa  Mycobacterium sp. JS623
Brite
KEGG Orthology (KO) [BR:msa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mycsm_06264
Enzymes [BR:msa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.12  peptide-methionine (R)-S-oxide reductase
     Mycsm_06264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SelR
Motif
Other DBs
NCBI-ProteinID: AGB26417
UniProt: L0J728
Position
6227192..6227650
Genome map
AA seq 152 aa AA seqDB search
MSQQYNNNPAAVDALSPEQYYVTQKNGTERPFTGEYWDNHKPGIYVDVVSGEPLFASVDK
FDSGTGWPSFTKPLDTGNVIEKRDVSHLMIRTEVRSAHGNSHLGHVFNDGPRDDGGLRYC
INSAALRFIHLDDLEAEGYGQYKSLFTKEETA
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagcaatacaacaacaatccggccgcggttgacgcgctctcgccggagcagtac
tacgtgacgcagaagaacggcaccgaacggcccttcaccggcgagtactgggacaaccac
aagccgggcatctacgtcgacgtcgtgtcgggtgagccgctgttcgcgtcggtcgacaaa
ttcgacagtggcaccggctggccgagtttcaccaaaccgctcgacacaggcaacgtgata
gagaaacgtgacgtctcgcacctgatgatccgcaccgaggtccgctccgcacacgggaac
agccatctcggccacgtgttcaacgacgggccgcgcgacgacggcgggctgcggtactgc
atcaactcggcggcgctgcggttcatccacctcgacgacctcgaggcggaaggatatggg
caatacaagtctttgttcacaaaagaggagacagcgtga

DBGET integrated database retrieval system