KEGG   Mycobacterium sp. JS623: Mycsm_06267Help
Entry
Mycsm_06267       CDS       T02423                                 

Definition
(GenBank) transcriptional regulator
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N Frankia_peptide
Motif
Other DBs
NCBI-ProteinID: AGB26420
UniProt: L0J4E6
Position
6229644..6230270
Genome map
AA seq 208 aa AA seqDB search
MTTALNGAGSDGPAVPAASVDDAFRDRLIEGLAASIGERGYRDSTVANIVRHARTSKRTF
YEQFASKEECLIELLRRNNEDLIANIQAAVDPEADWQLQIRQAAVAYVDHIGSRPAITLS
WIREAPALGLVARPLNRLAMEALTDMLVDLTDSPGFRRADLAPISRPLALILLGGLRELT
ALFVEDDRDVQGIVEHAVAAATAILGPR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagcgctcaacggagctggctccgacgggccggccgtcccagctgcgtccgtc
gacgacgccttccgcgaccggttgatcgagggcctggccgcctcgatcggtgagcgggga
taccgcgactccaccgttgccaacatcgttcggcatgcacggacgtccaagcgcacgttc
tacgagcagttcgccagcaaggaagagtgcctgatcgaactgcttcgcaggaacaacgag
gatctgatcgccaatatccaggcagccgtcgaccccgaggccgactggcagctccagatc
cgccaggcagcggtggcctacgtcgaccacatcgggtcgcggccggcgatcacgctgagc
tggatccgcgaggcgcccgcgctcggcctggtggcgcggccgctgaatcggctcgcgatg
gaggcgctcaccgacatgttggtcgacctcaccgacagcccaggttttcggcgagcggac
cttgccccgatctcgcgtccgctcgcgctgatcctgctgggcgggctgcgggagctgacg
gcactgttcgtggaggacgaccgcgacgtgcagggaatcgtcgagcacgcggtcgcggcc
gcaaccgcgattctgggcccgcgttaa

DBGET integrated database retrieval system