KEGG   Mycobacterium sp. JS623: Mycsm_06268Help
Entry
Mycsm_06268       CDS       T02423                                 

Definition
(GenBank) transcriptional regulator
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N HTH_23
Motif
Other DBs
NCBI-ProteinID: AGB26421
UniProt: L0J7X5
Position
complement(6230267..6230836)
Genome map
AA seq 189 aa AA seqDB search
MSDPVLESTRRRLTAKQADTVDRLGRAAVDLLSREGFAGLTVRRVAAEAGVGAATAYTYF
SSKEHLVAEVFWRRLAASPPAAHDSVDAATRVVDVLRHISLLVADEPEFACAVTNALLGK
DPDVEVLRLRIGRDIRDRLASALGSDIDPEIIDLLEMLYSGALVRAGMGYASYADIAQRL
EKSARLMLR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgatccggtcctggagtcgactcggcgccgcctgaccgccaagcaggccgacacc
gtcgaccgccttggccgcgccgccgttgacctcttgagtcgggagggattcgccggcctg
acggtgcggcgggtagccgcggaagccggcgtcggagccgcgaccgcctacacgtatttc
tcgtcgaaggagcacctcgtcgccgaggtgttctggcgtcggctggcggcatcgccgccc
gcggcgcacgactcggtcgacgcggctacccgggtggtcgacgtgctacgtcacatctcg
ctgctggtcgccgatgagcccgaattcgcttgtgccgtaaccaatgccctgctgggcaag
gacccagacgtcgaggtgctgcggctgcgcatcggccgcgacatccgcgaccggttggct
tccgcgcttggctccgacatcgatccggagatcatcgacttgctggagatgctgtattcc
ggcgcactggtgcgcgcgggaatgggctacgcgtcgtatgcggatatcgcgcagcggttg
gagaagtccgcgcggttgatgctgcgttaa

DBGET integrated database retrieval system